Peroxidases
Download
1 / 51

PEROXIDASES - PowerPoint PPT Presentation


  • 121 Views
  • Uploaded on

PEROXIDASES. Clara Ballesté, Núria Badia, Núria Conde i Susanna Camós. ÍNDEX. Introducció Classificació de diferents peroxidases Evolució : Concepte convergència-divergència Exemples: Cytochrome c – catalasa peroxidasa Cytochrome c (residus conservats/stamp/xam). INTRODUCCIÓ.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' PEROXIDASES' - noam


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Peroxidases

PEROXIDASES

Clara Ballesté, Núria Badia, Núria Conde i Susanna Camós


ÍNDEX

Introducció

Classificació de diferents peroxidases

Evolució: Concepte convergència-divergència

  • Exemples:

    • Cytochrome c – catalasa peroxidasa

    • Cytochrome c (residus conservats/stamp/xam)


Introducci
INTRODUCCIÓ

Peroxidases. Grup d’enzims amb funció oxido-reductora que utilitzen com a oxidant el H2O2. Aquest oxida al següent substrat de característiques reductores. (reacció bisubstrat). La majoria utilitzen com a cofactor el grup hemo (catalasa i citocrom c), però no totes (Monoamino oxidasa i Glutatió peroxidasa).



Proteïna

Família

Superfam.

Classe

α / 

All α

Heme-dependent peroxidases

FAD/NAD binding

Citocrom c

Thioredoxin

FAD linked reductasa

Glutatione peroxidase_like

Monodomain cytochrom c

Catalasa peroxidase

Glutatione peroxidase

Citocrom c

Catalasa peroxidase

MaoB

1cxc

2b2o

1o5w

1gp1



Selenocisteïna

Glutatió peroxidasa

  • 2 cadenes idèntiques monodomini (  sandwich)

  • Cofactor: Seleni

  • Funció: resposta estrés oxidatiu / Principal detoxificant de H2O2 en mamífers.

  • Reacció: ROOH + 2GSH  ->  ROH + GSSG + H2O


Monoaminooxidasa-B

  • 4 cadenes idèntiques : core //

  • Cofactor: FAD

  • Funció: Desaminació oxidativa de neurotransmissors i amines biogèniques.

  • Reacció: RCH2NH2 + H2O + O2 = RCHO + NH3 + H2O2


MAOB (Ratus Norvegicus): interacció cadena A-FAD

MAOB (Ratus Norvegicus): cadena B - FAD

Monoamino oxidasa (MAO)


Interaccions fad

Ser 24

Thr 435

Arg 45

Interaccions FAD


Glu 43

Arg 51

Val 244

Ala 44



Catalasa peroxidasa

  • Dues cadenes all-

  • Cofactor: Hemo (Fe)

  • Funció: Transportador d’electrons i resposta a estrés oxidatiu.

  • Reacció: H2O2 + Fe(III)-E → H2O + O=Fe(IV)-E



Trp

His

Arg

Trp

Motiu RXXWH

His

Asp



Arg 108

Estabilització càrregues negatives del grup carboxil de l’anell pirrol.

His 279


Citocrom c oxidasa

  • Molta diversitat dins la superfamília. Tota  i motiu conservat CXXCH.

  • Cofactor: Hemo (Fe)

  • Funció: Transportador d’electrons implicat en apoptosis, espermatogènesi i fosforilació oxidativa.


Cys

His

Motiu CXXCH

1CXC:_|PDBID|CHAIN|SEQUENCEQEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPNLYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGKMTFKLKKEADAHNIWAYLQQVAVRP

Citocrom c oxidasa – Residus conservats



α /

All α

Heme-dependent peroxidases

FAD/NAD binding

Citocrom c

FAD linked reductasa

Catalasa peroxidase

Citocrom c

Catalasa peroxidase

MaoB

1cxc

2b2o

1o5w

1gp1

Thioredoxin

Glutatione peroxidase_like

Monodomain cytochrom c

Glutatione peroxidase


CONVERGÈNCIA

- Citocrom C / Catalasa -


CITOCROM C

CATALASA

  • Aliniament per residus conservats : His19 – His279



DIVERGÈNCIA

- Citocrom C -


  • OBJECTIU:

    Estudi evolutiu és demostrar que dins la Superfamília CitocromC existeix similitut estructural entre els seus membres


Funció - Estructura - Seqüència

Homologia remota

Estructura

Funció

Seqüència

superfamilia


Citocrom c

Monodomain cytocrom c

N-terminal (heme c) domain of cytochrome cd 1-nitrit reductasa

Two-domain cytochrome c

Cytochrome bc1 domain

Quinoproteina alcohol dehydrogenase (c-terminal domain)

Dihemo cycochrome c peroxidasa

Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2

Dihemo cycochrome SoxA

Selecció de les proteïnes a estudiar


12-93 DomA1

Cadena A

94-183 DomA2

1h1o

213-293DomB1

Cadena B

294-383DomB2

Cadena A

1-150 DomA1

1h33

151-261 DomA2

Cadena B

No surt SCOP

1cxc

1 sol domini: amb qui?

86-165 DomA2

1pby

Cadena A

1-85 DomA1

1-164 DomA1

1eb7

Cadena A

165-323 DomA2

Separació en dominis: SCOP



cluster2

Sense 1h33A1






-Restringir visualment hèlixs conservades.

  • Modificar PDB

  • STAMP i XAM només per les hèlixs

  • Comparació del “model conservat” aconseguit amb Xam amb cada proteïna.

  • RasMol

Dominis 1

Per millorar-ho:


Grup hemo de Domini1

Grup hemo de Domini2

Representació per XAM de les hèlix conservades (Dominis 2)


Model Dominis2

Hemo de 1h33


  • En resum:

    • Selecció de les proteïnes a estudiar

    • STAMP

    • Selecció per dominis (1 i 2)

    • 1 STAMP per cada domini

    • Visualització Rasmol

    • XAM d’hèlixs conservades (per dominis)

    • Visualització Rasmol

    • Superposició amb proteïna inicial


  • BIBLIOGRAFIA:

    • Functional role of the “Aromatic cage” in Human Monoamine Oxidase B: Structures and catalytic properties of Tyr435 Mutant Proteins. Min Li et al. Biochemistry 2006, 45,4775-4784.

    • Identity and Functions of CxxC-Derived Motifs. Dimitri E. et al. Biochemistry 2003, 42, 11214-11225.

    • Structure and mechanism of Monoamine Oxidase. D.E.Edmonson et al. Current Medicinal Chemistry, 2004,11, 1983-1993.

    • Cytochrome c oxidase, ligands and electrons. Maurizio Brunori et al. Journal of Inorganic Biochemistry 99 (2005) 324-336.

    • Nitric oxide inhibition of respiration involves both competitive (heme) and noncompetitive (copper) binding to cytochrome c oxidase. Mason MG. et al. Department of Biologial Sciences, University of Essex, UK.

    • A theoretical study on the binding of O2, NO and CO to heme proteins. L.Mattias Blomberg et al. Stockholm University, Sweden.2005

      • Crystal structure of Mycobacterium tuberculosis catalase-peroxidase. Bertrand T. et al. Department of Biological Sciences, Centre for Molecular Microbiology and Infection, Flowers Building, Imperial College London, London, United Kingdom.2004


1.- Quin cofactor utilitza la glutatió peroxidasa a diferència del citocrom c oxidasa?

a) hemo

b) seleni

c) FAD

d) calci

e) zinc

2.- Quina/es de les seguents característiques són típiques de la catalasa:

a) hi ha dos tríades que formen la butxaca de l’hemo

b) una histidina estabilitza el Fe del grup hemo

c) una histidina estabilitza les càrregues negatives del grup pirrol (hemo)

d) la majoria d’interaccions del grup hemo són del tipus hidrofòbic

e) totes les anteriors

3.- Les peroxidases que hem estudiat (citocrom, catalasa, glutatió, monoamino oxidasa):

a) pertanyen a superfamílies diferents

b) pertanyen a la mateixa superfamília

c) fan la mateixa funció

d) b i c són correctes

e) a i c són correctes


4.- Quina és la característica comú entre les proteïnes MaoB, catalasa peroxidasa, citocrom c i glutatió peroxidasa?

a)Totes són hemoproteïnes

b)Pertanyen a la classe “tot α”

c)Les dues anteriors.

d)Catalitzen reaccions d’oxido-reducció

e)Cap de les anteriors és certa

5.-Pel que fa a la catalasa peroxidasa, indica la/les respostes correctes:

a)Existeixen dues tríades, a banda i banda del grup hemo, una de les quals tú un motiu molt conservat (RXXWH)

b)La Histidina279 i la Arginina108 estabilitzen les càrregues negatives del grup carboxil de l’anell pirrol.

c)Les dues anteriors

d)A part de ser una proteïna, a SCOP es classifica també com a superfamília

e)Totes les anteriors

6.-En l’estudi de la convergència evolutiva,

a)les proteïnes escollides van ser la MaoB i el citocrom c, per utilitzar com a cofactor el grup hemo

b)primer vam intentar alinear a partir de dues Histidines conservades en catalasa i citocrom c per veure si els hemo se superposaven, però els resultats no van ser satisfactoris.

c)Les dues anteriors

d)Els resultats de STAMP amb opcions avançades va ser molt bo.

e)Totes les anteriors.


7.-Pel que fa a l’estudi de divergència evolutiva: MaoB, catalasa peroxidasa, citocrom c i glutatió peroxidasa?

a)Ens vam centrar en la superfamília del citocrom c.

b)STAMP en opcions avançades donava scores molt baixos, motiu pel qual vam haver de separar-ho per dominis i fer 2 STAMPs.

c)les dues anteriors

d)Vam identificar les hèlixs conservades i les vam restringir per , a continuació, superposar el “model” de hèlixs conservades amb cada proteïna.

e)totes les anteriors.

8.-Respecte al citocrom c és cert que:

a)És de la classe α/β

b)Utilitza com a cofactor el FAD i presenta un domini conservat

c)Les dues anteriors són certes

d)Família amb molta diversitat i amb un motiu conservat

e)Totes les anteriors són certes.

9.-Per superposar els grups hemo:

a)Utilitzem STAMP perquè només tenim alguns residus conservats que els fem servir com a guia per aliniar la resta.

b)Utilitzem XAM per aliniar el domini C-terminal esperant que coincideixi l’hemo.

c)Després de modificar el PDB, superposem amb Xam utilitzant com a guia els hemo i el ferro, esperant que els residues importants coincideixin.

d)Les histidines estabilitzen el Fe, tot i no superposar-se exactament; La importància resta en la posició de l’anell.

e)c i d són certes.


10.-Afirmacions correctes: MaoB, catalasa peroxidasa, citocrom c i glutatió peroxidasa?

1.Per estudiar convergència (de residus en el lloc catalític)podem escollir proteïnes de igual funció però diferent família.

2.Estudiem divergència amb proteïnes d’una superfamília per demostrar que són diferents estructuralment.

3.Dues proteïnes que presenten convergència haurien de compartir residus essencials per la seva funció, tot i ser diferents.

4.Estudiem divergència en grups de proteïnes que no tenen ancestre comú.

a)1,2 i 3

b)1, 3

c)2, 4

d)4

e)1, 2, 3 i 4

11.-Explica el concepte d’homòlegs remots:

Quan dues proteïnes presenten la mateixa estructura , igual funció i es tracta de dues seqüències de la mateixa superfamília, llavors parlem d’homòlegs remots

12.-Explica els passos seguits per tal de fer l’estudi de convergència:

-Proteïnes utilitzades : citocrom c i catalasa.

-Aliniament (xam) de la His 19 i 279 de catalasa i citocrom respectivament,

-L’hemo no es superposa correctament

-Superposició ara aliniant l’hemo i el ferro (modifiquem el PDB per a que detecti els heteroatoms)

-Identificació de les Histidines ben aliniades