slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
16. Estudio pormenorizado de algunas proteínas PowerPoint Presentation
Download Presentation
16. Estudio pormenorizado de algunas proteínas

Loading in 2 Seconds...

play fullscreen
1 / 77

16. Estudio pormenorizado de algunas proteínas - PowerPoint PPT Presentation


  • 163 Views
  • Uploaded on

16. Estudio pormenorizado de algunas proteínas. Hemoproteínas: Hemoglobina y Mioglobina. Hemoproteínas. Son proteínas conjugadas cuyo grupo prostético es una porfirina coordinada a un ion metálico. Suelen estar relacionadas con todos los aspectos del metabolismo aeróbico

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about '16. Estudio pormenorizado de algunas proteínas' - miranda


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide2

Hemoproteínas:

Hemoglobina y Mioglobina

slide3

Hemoproteínas

Son proteínas conjugadas cuyo grupo prostético es una porfirina

coordinada a un ion metálico. Suelen estar relacionadas con todos los

aspectos del metabolismo aeróbico

- Transportadores de oxígeno como la hemoglobina y la mioglobina

- Clorofilas: porfirinas coordinadas a un ion Mg++

- Transportadores electrónicos como los citocromos

- Enzimas relacionadas con el transporte electrónico como la

citocromo oxidasa

- Enzimas relacionadas con el stress oxidativo, como las peroxidasas

- Coenzimas cobamídicas o corrinoides (vit. B12)

slide4

Hemo a:

citocromo oxidasa

slide5

Hemo c:

citocromo c

slide7

Met 80

Fe

Cys 14

Cys 17

Hemo c

His 18

Entorno del grupo hemo

en el citocromo c

slide8

Mg++

R:

Clorofilas

slide10

Transporte en sangre de O2

1 L de sangre arterial desprende 200 mL de O2 STP. Dada su poca

solubilidad, es de suponer que la mayoría circula en forma de alguna

combinación química.

En efecto, el oxígeno circula en combinación con la hemoglobina,

presente a la concentración de 145 g/L en sangre, toda ella en el

interior del hematíe (eritrocito, góbulo rojo), a su vez en cantidad

de unos 5 x 106 por ml.

El peso molecular de la hemoglobina es de 64000 (2.2 mmoles.L-1);

los 200 mL de O2 suponen 8.8 mmoles.L-1; por tanto, el transporte

se hace en razón de 8.8/2.2 = 4 moles de oxígeno por mol de hemo-

globina.

slide11

Teniendo en cuenta que en la molécula de hemoglobina hay cuatro

átomos de hierro, podemos decir que el transporte tiene lugar en

una proporción de un mol de oxígeno por mol de hierro.

La sangre arterial está equilibrada con una presión parcial de

oxígeno de aproximadamente 95-100 mm Hg. La sangre venosa

está equilibrada con una presión parcial de oxígeno de

aproximadamente 40 mm Hg.

La sangre arterial está saturada prácticamente a 100 %; la venosa,

un 70 %. Por tanto, el paso por los tejidos periféricos desprende un

30 % del oxígeno combinado con la hemoglobina.

slide12

Hemoglobina: proteína globular, conjugada y oligomérica

- Grupo prostético: hemo

hemo: protoporfirina IX + ion ferroso Fe2+

- Cuatro subunidades, iguales dos a dos:

Hemoglobina A1 (HbA1): a2b2

Hemoglobina A2 (HbA2): a2d2

Hemoglobina fetal (HbF): a2g2

Hemoglobina Gower 1: z2e2

Hemoglobina Gower 2: a2e2

Hemoglobina Portland: z2g2

- Se conoce, además, un gran número de hemoglobinas

mutantes.

slide13

Grupo Hemo b:

Protoporfirina IX + Fe

slide14

Hélice F

Entorno del

grupo hemo

en la

mioglobina

Fe++

His 93

Hélice E

slide15

Tanto en la hemoglobina como en la mioglobina,

el hierro siempre está en estado ferroso, Fe ++

Cuando el ion ferroso, Fe++ se oxida a férrico, Fe +++,

la hemoglobina se convierte en metahemoglobina, que

no es funcional

Conviene no confundir metahemoglobina con

oxihemoglobina, que es la forma oxigenada (pero no

oxidada) de la hemoglobina

Desoxihemoglobina + 4O2

Oxihemoglobina

slide16

Homología de secuencia a - b - Mioglobina

Cadena a V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLSH-----GSA 53

Cadena b VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNP 58

Mioglobina -GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 59

*: : * **** . * *.* *:: .* * * * .*. ..

Cadena a QVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHL 113

Cadena b KVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF 118

Mioglobina DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 119

.:* ** .* *: . : : .. : .*:: *. * :: :.::.. :: .* :

Cadena a PAEFTPAVHASLDKFLASVSTVLTSKYR------ 141

Cadena b GKEFTPPVQAAYQKVVAGVANALAHKYH------ 146

Mioglobina PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 153

:* . .:.: :* : . . :: :*:

slide17

Hélice C

C

Hélice D

Hélice F

Hélice E

Hélice B

Hél ce H

lice G

N

Hélice A

slide18

Subunidad b

Subunidad a

Mioglobina

slide19

Situación del

grupo hemo

slide20

a1

b1

b2

Hemoglobina A1

(forma T, desoxi-)

a2

slide21

a1

b2

b1

Hemoglobina A1

(forma R, oxi-)

a2

slide22

Entorno del

grupo hemo en la

desoxihemoglobina

Hélice F

His 87 (a)

His 92 (b)

Hélice E

slide23

Entorno del

grupo hemo en la

oxihemoglobina

O2

Hélice F

His 87 (a)

His 92 (b)

Hélice E

slide25

Vol., Mb

Vol., Hb

slide26

Concepto de P50

P50 Mb

P50 Hb

slide27

(Efecto Bohr)

pH 7.0

pH 7.4

pH 6.6

slide28

60 mmHg

40 mmHg

80 mmHg

slide29

0

0.1 mM

1 mM

slide30

Modelo MWC

Forma R, oxi-

s

s

s

s

s

s

s

s

s

s

L

i

i

i

i

i

i

i

i

i

i

Forma T, desoxi-

slide32

Contacto a-a

Arg 141 (C-t)

Asp 126

Arg 141 (C-t)

a2

a2

a1

Asp 126

Lys 127

Lys 127

a1

Oxi-

Desoxi-

slide34

Contacto a-b

His 146 (C-t)

His 146 (C-t)

Lys 40

b

b

Lys 40

b

Glu 43

a

Glu 43

a

Arg 92

Arg 92

Oxi-

Desoxi-

slide35

Contacto a-b

b

b

Asp 99

Asp 99

Tyr 42

a

a

Tyr 42

Forma T, desoxi-

Forma R, oxi-

slide37

Contacto b-b

His 2

His 2

His 143

Val 1

Val 1

His 143

Lys 82

Lys 82

Lys 82

Lys 82

His 143

Val 1

His 143

Val 1

His 2

2,3-BPG

His 2

Forma T, desoxi-

Forma R, oxi-

slide38

Movimiento del

ion Fe++ en la

oxigenación de la

hemoglobina

Forma T, desoxiHb

Forma R, oxiHb

slide40

Todos los organismos vivientes tienen mecanismos

para distinguir lo propio de lo extraño

- Hongos y plantas, por ejemplo, mediante la producción de

metabolitos secundarios potencialmente tóxicos para otros

organismos: antibióticos, alcaloides, etc.

- Bacterias, mediante el sistema de restricción de DNA: DNAs

extraños son degradados específicamente por las enzimas de

restricción

- Vertebrados, mediante el sistema inmune.

slide41

El sistema inmune consta de dos tipos de respuesta:

- La inmunidad celular, mediante la cual células inmunocompe-

tentes ( linfocitos T) eliminan células extrañas introducidas en

el organismo (p.e. un injerto, un tumor, una célula transforma-

da por un virus, etc.)

- La inmunidad humoral, en la que otras células inmunocom-

petentes (linfocitos B) producen proteínas específicas dirigidas

contra lo extraño, llamadas anticuerpos.

- Todos los anticuerpos pertenecen a una superfamilia de proteínas

conocidas como inmunoglobulinas

slide42

Llamamos antígeno a la molécula que, introducida en un orga-

nismo, produce una respuesta inmune, sea humoral o celular.

En la inmunidad humoral, el antígeno se une específicamente a

un linfocito B que produce un anticuerpo complementario. Este

linfocito se multiplica (clon celular) y se transforma en célula

plasmática o plasmocito, que es la célula encargada de la

producción de anticuerpos.

Cada linfocito B produce un solo y único tipo de anticuerpo. Por

esa razón, los anticuerpos obtenidos de un único clon de

linfocitos B reciben el nombre de anticuerpos monoclonales.

slide43

El estudio de las inmunoglobulinas se vio facilitado por la

naturaleza de los mielomas, tumores malignos de células

plasmáticas, que producen un solo tipo de anticuerpo (anti-

cuerpo monoclonal).

En algunos mielomas humanos se produce la llamada proteína

de Bence-Jones, que es excretada en la orina, a partir de la que

se puede purificar.

Es fácil inducir mielomas en ratón.

A partir de todas estas circunstancias se pueden obtener anti-

cuerpos químicamente puros (monoclonales) lo cual facilita

el estudio químico de las inmunoglobulinas

slide44

Porter, 1959:

El tratamiento con papaína escinde la molécula de

inmunoglobulina (Ig) en tres fragmentos, dos de ellos

idénticos: dos Fab y un Fc

Fab: Antigen Binding (fijador de antígeno)

Fc: Crystallizable (cristalizable)

Edelman, 1959:

El tratamiento con mercaptoetanol y guanidina 8M, seguido

de cromatografía, disocia la Ig en dos componentes de pesos

moleculares 50 kDa (H, de heavy, pesado) y 25 kDa (L, de

light, ligero). Como el peso molecular de la Ig nativa es de

150 kDa, se deduce que su estructura es H2L2

slide45

Por estudios inmunológicos, se detectan los siguientes isotipos:

- Cadena ligera: k, l

- Cadena pesada: g, a, m, d, e

En los dominios constantes puede haber una ligera variabilidad

en cada cadena (afecta a uno o dos aminoácidos) dando lugar a

las variantes conocidas como alotipos

En los dominios variables hay muy poca homología de secuencia;

cada anticuerpo es único hacia su antígeno: los idiotipos

En cualquier caso, en cada anticuerpo las dos cadenas ligeras y las

dos pesadas son iguales entre sí.

slide46

L

Cadena pesada o H: g, a, m, d, e

Cadena ligera o L: k, l

N

VL

N

CL

VH

C

CH1

H

C

CH3

CH2

H

C

CH3

CH2

CH1

C

CL

VH

Puente disulfuro

N

VL

Inmunoglobulinas

N

L

slide47

Cadenas ligeras

212 aminoácidos

2 dominios:

VL, N-t (108aa)

CL, C-t (104 aa)

Cadenas pesadas

Variable; 450 aminoácidos en IgG

Cuatro o cinco dominios:

VH, N-t (108 aa)

CH1, CH2, CH3 (y CH4)

En los dominios constantes hay posibilidad de

variaciones alotípicas (uno o dos aminoácidos solamente)

slide48

Regiones hipervariables (CDR) en el dominio

variable de las cadenas H y L en las Ig

L

N

C

1

30

50

93

H

N

C

35

60

87

105

slide49

Dominio de

Inmunoglobulina

slide51

VH

Cadena pesada, H

N

C

CH1

CH3

Oligosacárido

CH2

slide52

L

Cys H128

Cys L 214 (C-t)

H

Puente disulfuro entre cadenas pesada y ligera

slide53

Fab

Inmunoglobulina G

H1

H2

Oligosacárido

L1

Fab

L2

Fc

slide54

g2k2 , g2l2

Inmunoglobulina G

- Constituye el 70-80 % de las Ig séricas

- Contingente mayoritario de la respuesta inmune secundaria

- Cuatro tipos distintos: IgG1, IgG2, IgG3, IgG4

- Monomérica

- Bajo contenido en carbohidrato (2-3 %)

slide55

Inmunoglobulina A

(a2k2)2 , (a2l2)2

- Constituye el 10-20 % de las Ig séricas

- Es la Ig propia de las secreciones (jugo gástrico, saliva, leche)

- Dos tipos: IgA1, IgA2

- Normalmente dimérica: unión covalente por el péptido J

- Alto contenido en carbohidrato (7-12 %)

slide56

(m2k2)5 , (m2l2)5

Inmunoglobulina M

- Constituye el 5-10 % de las Ig séricas

- Es la respuesta inmune primaria

- Cinco dominios en la cadena pesada

- Elevada proporción de carbohidrato (12 %)

- Pentámero unido por disulfuros y un péptido J

slide57

d2k2 , d2l2

Inmunoglobulina D

- Muy baja concentración en suero (1 %)

- Posiblemente relacionada con el receptor de antígeno

- Alto contenido en carbohidrato (9-14 %)

slide58

e2k2 , e2l2

Inmunoglobulina E

- La más minoritaria

- Cinco dominios en la cadena H

- Membrana de mastocitos y basófilos

- Relacionada con inmunidad a parásitos helmínticos

- Relacionada con fenómenos de hipersensibilidad

(alergia) inmediata: fiebre del heno, asma.

- Alto contenido en carbohidrato

slide60

Proteína fibrosa, constituída por empaquetamiento de

moléculas de tropocolágeno o monómero de colágeno

Tropocolágeno: tres helicoides entrecruzados, cada uno

de peso molecular en torno a los 300 kDa, alrededor de 1000

aminoácidos, con una gran cantidad de residuos de Gly, así

como de Pro, normal o hidroxilada.

Los residuos de Lys pueden aparecer asimismo modificados,

bien como 5-hidroxilisina, o como lisina aldehídica (Al-lisina).

Es muy abundante en todos los tejidos de origen mesodérmico,

particularmente en tendones, dermis, fascias y hueso.

slide61

Tropocolágeno

Disposición de los monómeros

de colágeno en la microfibrilla,

que da lugar a un patrón

estriado al microscopio electrónico

slide62

Las cadenas de tropocolágeno aparecen unidas unas a otras

en la microfibrilla mediante:

- Cadena lateral de al-lisina unida a cadena lateral de lisina no

modificada a través de base de Schiff y posterior reducción

- Cadena lateral de al-lisina unida a otra al-lisina a través de

condensación aldólica

- Enlaces de hidrógeno entre el grupo -C=O de la prolina y el

-N-H de la glicina, siempre intercatenarios

slide63

Señal

MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDR 50

DVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSE 100

SPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPP 150

GPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQG 200

FQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQ 250

GARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ 300

MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVG 350

AKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGAN 400

GAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGE 450

PGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADG 500

VAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPD 550

GKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV 600

PGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAG 650

PPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGAN 700

GAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGP 750

KGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPG 800

DRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPP 850

GPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP 900

AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPG 950

PQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPM 1000

GPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGA 1050

PGAPGPVGPAGKSGDRGETGPAGPAGPVGPAGARGPAGPQGPRGDKGETG 1100

EQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAP 1150

GKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF 1200

LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEG 1250

SRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCV 1300

YPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAI 1350

QLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLKGSNEIEIRA 1400

EGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAP 1450

DQEFGFDVGPVCFL 1464

Propéptido

N-terminal

Helicoide

Propéptido

C-terminal

slide64

GKTGPPGPAGQDGRPGPPGPPGARGQAGVM

GFPGPKGAAGEPGKAGERGVPGPPGAVGPA

GKDGEAGAQGPPGPAGPAGERGEQGPAGSP

GFQGLPGPAGPPGEAGKPGEQGVPGDLGAP

GPSGARGERGFPGERGVQGPPGPAGPRGAN

Fragmento de secuencia del colágeno aI(1)

(Muchos residuos de Pro aparecen hidroxilados)

slide66

Cada helicoide es levógiro,

pero se entrelazan en

forma dextrógira

Helicoide triple del

tropocolágeno

(fragmento, 14 aa/helicoide)

slide67

Tropocolágeno

(fragmento)

Vista lateral

Vista frontal

slide68

Glicina cada

tres residuos

Enlaces H a otras cadenas

(grupo -C=O peptídico)

Helicoide aislado del tropocolágeno

slide69

Residuos de Gly

en tropocolágeno

slide70

Hidroxilación de prolina

Enzima: procolágeno:prolina monooxigenasa

(prolil hidroxilasa), requiere ácido ascórbico

La hidroxilación de prolina favorece la formación de enlaces H

entre las cadenas

slide71

Hidroxilación de lisina

Enzima: Procolágeno:lisina monooxigenasa

(lisil hidroxilasa), requiere ácido ascórbico

La lisina hidroxilada es el punto de unión

de oligosacáridos al colágeno

slide72

Al-Lisina

Enzima: lisil aminooxidasa

Forma enlaces cruzados

(entrecruzamientos) covalentes

entre los helicoides del colágeno

slide73

Formación de entrecruzamiento covalente entre cadenas de

colágeno a través de lisina y al-lisina, (vía base de Schiff)

slide74

Formación de entrecruzamiento covalente entre cadenas de

colágeno a través de dos al-lisinas, (vía condensación aldólica)

slide75

Tipos de colágeno

      • Tipo I [a1(I)]2a2(I) Mayoritario (huesos, piel, tendones)
      • Tipo II [a1(II)]3 Cartílago, vítreo
      • Tipo III [a1(III)]3 Vasos sanguíneos, cicatrices
      • Tipo IV [a1(IV)]3 Membrana basal, cristalino
  • [a2(IV)]3
  • Tipo V [a1(V)]2a2(V) Superficies celulares
  • [a1(V)]3
  • [a1(V)][a2(V)][a3(V)]
  • Tipo VI Íntima de la aorta
slide76

Elastina:

Tramos sin estructura definida entrecruzados

por desmosina

slide77

Formación de entrecruzamiento covalente entre cadenas de

elastina a través de cuatro lisinas, (vía formación de desmosina)