prakarya kerajinan dari bahan kayu n.
Skip this Video
Loading SlideShow in 5 Seconds..
PRAKARYA Kerajinan dari Bahan Kayu PowerPoint Presentation
Download Presentation
PRAKARYA Kerajinan dari Bahan Kayu

Loading in 2 Seconds...

play fullscreen
1 / 24

PRAKARYA Kerajinan dari Bahan Kayu - PowerPoint PPT Presentation

  • Uploaded on

PRAKARYA Kerajinan dari Bahan Kayu. Kompetensi Dasar (KD) : 1.1. Menghargai keberagaman produk kerajinan di daerah setempat sebagai anugerah Tuhan

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'PRAKARYA Kerajinan dari Bahan Kayu' - milly

Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

Kompetensi Dasar (KD) :

1.1. Menghargai keberagaman produk kerajinan di daerah setempat sebagai anugerah Tuhan

2.1. Menghargai rasa ingin tahu dan sikap santun dalam menggali informasi tentang keberagaman karya kerajinan daerah setempat sebagai wujud cinta tanah air dan bangga pada produk Indonesia

2.2. Menghayati perilaku jujur, percaya diri, dan mandiri dalam merancang dan membuat karya kerajinan.

2.3. Menghargai kemauan bertoleransi, disiplin dan bertanggung jawab dalam penggunaan alat dan bahan, serta teliti dan rapi saat melakukan berbagai kegiatan pembuatan karya kerajinan.


Kompetensi Dasar (KD) :

3.1. Memahami desain pembuatan dan pengemasan karya bahan alam berdasarkan konsep dan prosedur berkarya sesuai wilayah setempat.

4.1 Mencoba membuat karya kerajinan dan pengemasan dari bahan alam sesuai desain dan bahan alam yang ada di wilayah setempat.

  • HutanIndonesia disebut ….
  • HutanIndonesia termasuk ….

Wujudsyukurdengankekayaanalam, khususnyahutandi Indonesia :

  • Melestarikanhutan, reboisasi
  • MendukungpencegahanpenebanganhutansecaraIlegal
  • Menanamtanaman/apotikhidupdisekitarrumah



Kelasawetkayuadalahtingkatkekuatanalamisesuatujeniskayuterhadappengaruhkelembaban, pengaruhiklimdancuaca, sertaseranganhama.

Adalima penggolongankelasawetkayu (makinbesarangkakelasnya, makamakinrendahsifatkeawetannya). yaitusebagaiberikut:

Kelasawet I (25 tahun)

Kelasawet II (15-25 tahun)

Kelasawet III (10-15 tahun)

Kelasawet IV (5-10 tahun)

Kelasawet V (<5 tahun)



Kelaskuatkayuadalahtingkatketahananalamisuatujeniskayuterhadapkekuatanmekanis (beban) kayu yang terdiridariberatjenis, keteguhanlengkungmutlak (klm), danketeguhantekanmutlak (ktm).

KelaskuatkayudinyatakandalamKelasKuat I, II, III, IV dan V. Makin besarangkakelasnyamakinrendahkekuatannya. Berikutadalahtabelkelaskuatkayu:



KayujatitermasukkayudenganKelasAwet I, II danKelasKuat I, II. Kayujatijugaterbuktitahanterhadapjamur, rayapdanseranggalainnyakarenakandunganminyakdidalamkayuitusendiri.



KayuMerbautermasukkayudenganKelasAwet I, II danKelasKuat I, II. Warnakayumerbaucoklatkemerahandankadangdisertaiadanya highlight kuning. PohonmerbaubanyakditemuidiIrian / Papua.



KayuMahonitermasukkayudenganKelasAwet III danKelasKuat II, III. PohonmahonibanyakditemuidiantarahutanJatidiPulauJawa



KayutermasukkayudenganKelasAwet I, II, III danKelasKuat I, II. Kayubangkiraitermasukjeniskayu yang tahanterhadapcuaca . PohonBangkiraibanyakditemukandipulau Kalimantan.



KayusonokelingtermasukkayudenganKelasAwet I danKelasKuat II. Pohonsonokelinghanyatumbuhdihutan-hutandiJawa Tengah danJawaTimur

bentuk ukiran




Gunungan (Kayon / kekayon)

  • Gunungan adalah simbol dari jagad raya. Puncaknya adalah lambang keagungan dan keesaan.
  • Bentuk simbol ini memang menyerupai gunung
  • Orang Jawa memasang motif gunungan di rumah mereka sebagi pengharapan akan adanya ketenteraman dan lindungan Tuhan dalam rumah tersebut.


  • Arti harafiah kata “lung” sendiri yang berarti batang tumbuhan yang masih muda, simbol ini berupa tangkai, buah, bunga dan daun yang distilir.
  • Jenis tumbuhan yang sering digunakan adalah tumbuhan teratai, kluwih, melati, beringin, buah keben dsb.
  • Simbol ini melambangkan kesuburan sebagai sumberpenghidupan di muka bumi.


  • Ukiranberbentuk wajah hantu / raksasa. Banaspati ini melambangkan raksasa yang akan menelan / memakan segala sesuatu yang jahat yang hendak masuk ke dalam rumah. Karenanya ukiranini biasa ditempatkan di bagian depan bangunan, seperti pagar, gerbang, atau pintu masuk.
tugas portofolio
  • TuliskanbentukukirandanmaknasimbolikpadaukirandasarrumahToraja (Tongkonan)