MBP Peptides

Dec 01, 2014

10 likes | 137 Views

Supplementary Figure 8. MBP Peptides. MBP. MOG. MOG Peptides. PLP. PLP Peptides.

Share Presentation

Embed Code

Link

mbp
mbp peptides
mog peptides
plp peptides
supplementary figure 8

mackensie-lott

Download Presentation

MBP Peptides

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Supplementary Figure 8 MBP Peptides MBP MOG MOG Peptides PLP PLP Peptides

Antimicrobial Peptides

Antimicrobial Peptides. An ancient immune system. Antimicrobial peptides: What are they?. Small proteins of cationic charge involved in host innate immune defense. Antimicrobial peptides: Where are they?. In everything from Amoebas to Humans (incl. Bacteria), Abundant in vertebrates in:

1.84k views • 16 slides

MBP 1018Y: Oncology

MBP 1018Y: Oncology. Wednesdays, 10 a.m. – 12 noon January 11 – May 02, 2012 inclusive 610 University Avenue, Room 7-605. Outline. Introductions Course Contact Information Significant Dates Course Schedule Course Overview – Goal, Format Course Evaluation Tutorial Schedule Tutorial.

501 views • 41 slides

MBP 1018Y: Oncology

MBP 1018Y: Oncology. Wednesdays, 10 a.m. – 12 noon January 12 – May 04, 2011 inclusive 620 University Avenue, Room 7-709 (CFIBCR Seminar Room). Outline. Introductions Course Contact Information Significant Dates Course Overview – Goal, Format Course Evaluation Course Schedule Tutorial.

533 views • 38 slides

MBP ASEAN: ETHNIC CONFLICT

MBP ASEAN: ETHNIC CONFLICT. 11 May 2010. MAP ASEAN. Understanding: 1. Religious Conflict 2. Ethnic Conflict 3. Vertical Conflict (Government-Group/Sub-nation), ex/ GAM Vs Pemerintah Indonesia 4. Horizontal Conflict. Basic for Resurgence. Religious :

304 views • 7 slides

PEPTIDES

PEPTIDES. Tissue damage, allergic reactions, viral infections and other inflammatory events activate a series of proteolytic rections that generate BK and KD in the circulation or tissues

446 views • 29 slides

Peptides

Peptides. Martina Zlámalová. Peptide Synthesis Methodology. is carried out by FMOC chemistry, using PEG-Polystyrene resins peptides are cleaved from the resin and de-protected using cleavage cocktail peptides are precipitated from the cocktail using cold diethyl ether

351 views • 9 slides

Peptides

References listed in Table 1S Akoun, G.M. et al. (1985. Serum neurone-specific enolase, A marker for disease extent and response to therapy for small-cell lung cancer. Chest. 87, 39-43

152 views • 1 slides

MBP-  1 -AT

(kDa). GST-UIM. A. HIS-HHR23a. MBP-  1 -AT. Nus-UBL. 97.4. *. 66.3. *. *. 55.4. 36.5. *. T I S P. T I S P. T I S P. T I S P. B. (kDa). Nus-UBL. His-HHR23a. GST-UIM. MBP- a 1 -AT. 97.4. 66.3. 55.4. 36.5. 31.0. 21.5. 14.4.

120 views • 1 slides

27.7 Peptides

27.7 Peptides. Peptides. Peptides are compounds in which an amide bond links the amino group of one a -amino acid and the carboxyl group of another. An amide bond of this type is often referred to as a peptide bond. H. H. O. O. +. +. –. –. O. O. H 3 N. H 3 N. C. C. C. C. CH 3.

289 views • 11 slides

MBP-IpbHLH2

Additional file 4. A. MBP-IpMYB1. B. MBP-PhAN1. C. MBP-IpbHLH2. D. MBP-MlMYB1. E. IpbHLH2 : EEPNVNHVLAERRRREKLNERFIILRSLVPFVTKMDKASILGDTIEYVKQLRRRIQELEAPTEVDRQ PhAN1 : EEPSGNHVLAERRRREKLNERFIILRSLVPFVTKMDKASILGDTIEYVKQLRKKVQDLEARANQTEA.

140 views • 1 slides

MBP 1028: Radiation Physics

MBP 1028: Radiation Physics. 1) Intro, Matter, and Radiation a) Radiation uses: diagnosis, treatment, power b) Nuclear Reactor for power i) Cherenkov radiation c) Forces ( Patel ) d) Matter i) Electrons, neutrons, protons, atomic structure, binding energy e) Radiation i) EM radiation

1.45k views • 89 slides

synthetic peptides

Peptides are short chains of amino acids linked by covalent chemical bonds named “peptide bond”. Peptide bonds are formed by the linkage between the carboxyl group of one amino acid and the amino group of another.

96 views • 1 slides

Peptides Ireland

Peptides Ireland Allenwood Cross, Allenwood, Co Kildare, W91 YK82 Ireland 045-870970 Info@peptidesireland.com http://peptidesireland.com/ Peptides Ireland off a wide range of peptides for research purposes. We offer a range of products such as GHRP-2, GHRP-6, I-GF1, BPC157. All of these are capable of creating great results in lab tests and related scientific studies. We offer the highest quality and lowest prices you will find anywhere online in Ireland. Growth Hormone releasing peptides are well known in the scientific world for their benefits. The main benefits of long term use are better skin, leaner physique, better hair and nail quality and a more youthful looking appearance. You can view our full range of products on our website.

41 views • 1 slides

Ghrelin Peptides

Creative Peptides is one of the primary suppliers of diabetes related peptides with a range of more than 100 peptides, from milligrams to kilograms, generic standard to cGMP (current Good Manufacturing Practice) standard.https://www.creative-peptides.com/research-areas/peptides-in-diabetes.html

49 views • 3 slides

Peptides clenbuterol

From our online shop, you can buy liquids like CLENBUTEROL 200MCG for use in research, made with top quality ingredients for best results. Visit: https://www.buysequence.com/catalog-research-liquids/clenbuterol-200mcg-60ml-66.html

66 views • 6 slides

Antigen Peptides

Mimicking specific parts of the target protein, peptide antigens can provide much flexibility for scientific research. More at https://www.creative-peptides.com/services/special-antigen-peptides-services.html

14 views • 1 slides

Peptides Online

Buy Peptides Online at Pinnacle Peptides!

16 views • 1 slides

Peptides

Peptides For Sale!

47 views • 2 slides

PEPTIDES

PEPTIDES. Tissue damage, allergic reactions, viral infections and other inflammatory events activate a series of proteolytic rections that generate BK and KD in the circulation or tissues

309 views • 29 slides

Collagen peptides

With age, collagen an abundant protein in your body reduces and your skin loses elasticity. To regain the health of your skin you need collagen peptides or supplements to balance the amount of collagen required by the body. Collagen Hydrolysate Powder is one such supplement that can benefit you immensely. Include collagen in your daily nutrition and experience great benefits. For more information on quality collagen supplement visit our site now!

52 views • 1 slides

Lab Peptides

As passion in peptides has grown, so have techniques for manufacturing it as well as examining new applications for it. Visit : https://labpeptides.org/

48 views • 3 slides

More Related