implementasi solusi informasi bisnis
Download
Skip this Video
Download Presentation
IMPLEMENTASI SOLUSI INFORMASI BISNIS

Loading in 2 Seconds...

play fullscreen
1 / 14

IMPLEMENTASI SOLUSI INFORMASI BISNIS - PowerPoint PPT Presentation


  • 228 Views
  • Uploaded on

IMPLEMENTASI SOLUSI INFORMASI BISNIS. Pertemuan II I RUANG LINGKUP E-BISNIS. Ruang lingkup e- bisnis. E-BISNIS. E-COMMERCE. INTERNET COMMERCE. E D I. WEB-COMMERCE. E-BISNIS.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'IMPLEMENTASI SOLUSI INFORMASI BISNIS' - liv


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
implementasi solusi informasi bisnis

IMPLEMENTASI SOLUSI INFORMASI BISNIS

Pertemuan III

RUANG LINGKUP E-BISNIS

ruang lingkup e bisnis
Ruanglingkupe-bisnis

E-BISNIS

E-COMMERCE

INTERNET COMMERCE

E D I

WEB-COMMERCE

e bisnis
E-BISNIS

Merupakanlingkupaktivitasperdagangansecaraelektronikdalamartiluassertaterpentingdanterbesardari e-business adalah ecommerce, dimanaberbagaiaktivitastransaksijualbelidilakukanmelalui medium internet. Karenasangatlebarnyaspektrumprosesdaritransaksijualbeli yang ada, sangatsulitmenentukanruanglingkupataubatasandari domain e-commerce. Salahsatucara yang dapatdipergunakanuntukdapatmengertibatasan-batasandarisebuah e-commerce adalahdenganmencobamengkajidanmelihatfenomenabisnistersebutdariberbagaidimensi, yaitu ;

teknologi
Teknologi
  • Kontributorterbesar yang memungkinkanterjadinya e-commerce adalahteknologiinformasi, dalamhaliniperkembanganpesatteknologikomputerdantelekomunikasi. Tidakdapatdipungkiribahwa arena jualbelididuniamayaterbentukkarenaterhubungnyaberjuta-jutakomputerkedalamsebuahjaringanraksasa (internet).
marketing dan new consumer processes
Marketing dan “New Consumer Processes”

Dari segipemasaran, e-commerce seringdilihatsebagaisebuahkanalataucarabaruuntukberhubungandenganpelanggan. Melalui e-commerce jangkauansebuahperusahaanmenjadisemakinluaskarena yang bersangkutandapatmemasarkanprodukdanjasanyakeseluruhduniatanpamemperhatikanbatasan-batasangeografis.

electronic linkage
Electronic Linkage

Denganadanya e-commerce, makaduabuahdivisidapatbekerjasamasecaraefisienmelaluipertukaran data elektronis; demikianjugaantaraduabuahkelompokberbedasepertimisalnyaantarakantorpemerintahdenganmasyarakatnya; ataumungkinantarapelanggandenganperusahaan-perusahaantertentu

information value adding
Information Value Adding

Di dalam e-commerce, bahanbaku yang paling pentingadalahinformasi. Sehubungandenganhalini, prosespertambahannilai (value adding processes) menjadikunciterselenggaranyasebuahmekanisme e-commerce.

market making
Market-Making

E-commerce dikatakansebagai market-making karenakeberadaannyasecaralangsungtelahmembentuksebuahpasarperdagangantersendiri yang mempertemukanberjuta-jutapenjualdanpembelidisebuahpasar digital maya (e-market). Di pasarmayainiterjadiperdagangansecaraterbukadanbebas, karenamasing-masingpenjualdanpembelidapatbertemusecaraefisientanpaperantara.

service infrastructure
Service Infrastructure

Konsep e-commerce ternyatatidakhanyamembuahkanmekanismetransaksijualbelisemata, namunternyatabanyaksekalijasa-jasabaru yang diperlukansebagaisaranapendukungaktivitasjualbeliproduktersebut.

e commerce
E-COMMERCE

Merupakanlingkupperdagangan yang dilakukansecaraelektronikdimanadidalamnyatermasuk :

  • perdagangan via internet (internet commerce)
  • perdagangandenganfasilitas web internet (web e-commerce)
  • perdagangandengan system pertukaran data terstruktursecaraelektronik (Elektronik Data Interchange/EDI).
pentingnya e commerce
Pentingnya e-commerce

Orang yang inginmembelibarangatautransaksilewat internet hanyamembutuhkanakses internet dan interface-nyamenggunakan web browser Menjadikan portal e-commerce / e-shop tidaksekedar portal belanja, tapimenjaditempatberkumpulnyakomunitasdenganmembangun basis komunitas, membangunkonseppasarbukansekedartempatjualbelidansebagaipusatinformasi(release,product review, konsultasi, etc)

Pengelolaan yang berorientasipadapelayanan, kombinasikonsepsipelayanankonvensionaldan virtual : Responsif (respon yang cepatdanramah), Dinamis,InformatifdankomunikatifInformasi yang up to date, komunikasi multi-arah yang dinamis Model pembayaran : kartukreditatau transfer.

tahapan tahapan dalam transaksi elektronik melalui e commerce
Tahapan-tahapandalamtransaksielektronikmelalui e-commerce

dapatdiurutkansebagaiberikut;

  • E-customer dan e-merchant bertemudalamduniamayamelalui server yang disewadari Internet Server Provider (ISP) oleh e-merchant.
  • Transaksimelalui e-commerce disertai term of use dan sales term condition atauklausulastandar, yang padaumumnya e-merchant telahmeletakkanklausulakesepakatanpada website-nya, sedangkan e-customer jikaberminattinggalmemilihtombol accept ataumenerima.
  • Penerimaan e-customer melaluimekanisme “klik” tersebutsebagaiperwujudandarikesepakatan yang tentunyamengikatpihak e-merchant.
slide13
Padasaatkeduabelahpihakmencapaikesepakatan, kemudiandiikutidenganprosespembayaran, yang melibatkandua bank perantaradarimasing-masingpihakyaitu acquiring merchant bank dan issuing customer bank.Prosedurnya e-customer memerintahkankepada issuing customer bank untukdanatasnama e-customer melakukansejumlahpembayaranatashargabarangkepada acquiring merchant bank yang ditujukankepada e-merchant.
  • Setelahprosespembayaranselesaikemudiandiikutidenganprosespemenuhanprestasiolehpihak e-merchant berupapengirimanbarangsesuaidengankesepakatanmengenaisaatpenyerahandanspesifikasibarang.
ad