bab 12 menentukan strategi produk n.
Download
Skip this Video
Download Presentation
Bab 12 Menentukan Strategi Produk

Loading in 2 Seconds...

play fullscreen
1 / 18

Bab 12 Menentukan Strategi Produk - PowerPoint PPT Presentation


  • 2520 Views
  • Uploaded on

Bab 12 Menentukan Strategi Produk. Pentingnya Produk. Inti Merek yang hebat adalah Produk Yang Hebat Produk adalah elemen kunci dalam penawaran pasar Pemimpin pasar biasanya menawarkan produk yang bermutu tinggi yang memberikan nilai pelanggan yang unggul. Definisi Produk.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Bab 12 Menentukan Strategi Produk' - lazaro


Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
pentingnya produk
PentingnyaProduk
  • IntiMerek yang hebatadalahProduk Yang Hebat
  • Produkadalahelemenkuncidalampenawaranpasar
  • Pemimpinpasarbiasanyamenawarkanproduk yang bermututinggiyang memberikannilaipelanggan yang unggul
definisi produk
DefinisiProduk
  • Segalasesuatu yang dapatditawarkankepadapasaruntukmemuaskansuatukeinginanataukebutuhan, termasukfisik, jasa, pengalaman, acara, orangtempat, properti, organisasidan etc

Lima Tingkat Produk: HierarkiNilaiPelanggan

KompenenPenawaranPasar

klasifikasi produk
KlasifikasiProduk
  • PemasarMengklasifikasikanprodukberdasarkan:
    • Ketahanan/Durabilitas
    • Keberwujudan/Tangibility
    • Kegunaan KonsumenatauIndustri
  • Pemasarmenggolongkan 3 kelompokmenurutKetahanan & Keberwujudannya
    • Barang-barangtahan lama
    • Barang-barangtidaktahan lama
    • Jasa
klasifikasi barang konsumen
KlasifikasiBarangKonsumen
  • Barangsehari-hari (Convenience goods)
    • Barangkebutuhanpokok
    • Barang impulse (dibelitanpaperencanaan)
    • Barangdarurat (Dibelisaatmendesak)
  • Barangbelanja (Shopping Goods)
    • BarangHomogen (kualitasserupa, hargacukupberbeda)
    • BarangHeterogen (Fiturdanjasaberbedalebihpentingdariharga)
  • BarangKhusus (Specialty Goods): mempunyaikarakteristikdanidentifikasimerek yang unikdancukupbanyakpembeli yang inginpembeliankhusus
  • Barang yang tidakdicari (Unsought Goods): barang yang tidakdikenalatautidakterpikirkanuntukdibeli
klasifikasi barang industri
KlasifikasiBarangIndustri
  • BahandanSukuCadang: Barang yang seluruhnyamenjadibagiandariprodukprodusenie: bahanmentah, bahandansukucadangmanufaktur.
  • Barang Modal: barangtahan lama yang menfasilitasipengembangandanpengelolaanprodukjadi, ie: instalasi & peralatan
  • LayananBisnis & Pasokan: barangdanjasajangkapendekyangmanfasilitasipengembangandanpengelolaanprodukjadi, ie: MRO, Barangpemeliharaandanperbaikan
diferensiasi
Diferensiasi
  • Agar dapatdijadikanmerek, produkharusdidiferensiasikan, terdiri:
  • DiferensiasiProduk
  • DiferensiasiJasa
hubungan produk merek hirearki produk
Hubunganproduk & Merek: HirearkiProduk

Unit yang berbedadidalamliniprodukataumerek yang dibedakanberdasarkanukuran, harga, tampilan, atribut

Asuransijiwaberjangka PRUDENTIAL yang dpatdiperbarui

Barang

Sekelompokbarangdidalamliniproduk yang berbagisatudaribeberapakemungkinanbentukproduk

TipeProduk

AsuransijiwaBerjangka

Kelompokprodukdidalamkelasproduk yang berhubunganeratkarenamempunyaifungsi yang serupa, dijualkepadakelompokpelanggan, gerai/saluranataumemilikiharga yang sama

LiniProduk

AsuransiJiwa

Kelompokprodukdidalamkeluargaproduk yang dikenaldenganfungsionalitasygkoheren

KelasProduk

Instrumenkeuangan

Tabungan danpenghasilan

Semuakelasproduk yang dapatmemuaskankebutuhanintidenganefektif

KeluargaProduk

KeluargaKebutuhan

Kebutuhaninti yang mendasarikeberadaankeluargaproduk

Keamanan

sistem bauran produk
Sistem & BauranProduk
  • SistemProduk: kelompokbarang yang berbedatetapiberhubungandanberfungsidengancara yang kompatibelie: liniproduksmartphone, e-book, kamera
  • Bauranproduk: Kumpulan semuaprodukdanbarang yang ditawarkanuntukdijualolehpenjualtertentu, terdiridari: lebar, Panjang, Kedalaman, konsistensi
analisis lini produk
AnalisisLiniProduk
  • Penjualan & Laba

Pemasarharusmengetahuipenjualandanlabasetiap item dalamliniprodukmerekaitemmana yang dibuat, dipertahankan, dipanen, divestasi

  • ProdukInti: Volume penjualantinggi, dipromosikanbesar-besaran, margin rendah
  • Produkdasar: volume penjualanrendah, tanpapromosi, margin tinggi
  • ProdukKhusus:VolumePenjualanrendah, promosibesar-besaran
  • Barangsehari-hari: Volume tinggi, kurangpromosi, margin tinggi
analisis lini produk profil pasar
AnalisisLiniProduk: ProfilPasar

Manajerliniharusmeninjaubagaimanaliniitudiposisikanterhadaplinipesaing.

  • Peta product (product map) memperlihatkan item pesaing, kemungkinanlokasiuntuk item baru, dansegmenpasar.

ContohPetaProduk Perusahaan kertas

memperpanjang lini produk
MemperpanjangLiniProduk

Perusahaan inginmemperpanjangliniprodukdengantujuan:

  • Menciptakanliniprodukuntukmendorongpenjualankeatas
  • Menciptakanliniproduk yang memfasilitasipenjualansilang
  • Menciptakanliniproduk yang terlindungdaripeningkatandanpenurunankondisiekonomi
  • Cara memperpanjangliniproduk:
  • Perpanjanganlini(line streching),yakniketikaperusahaanmemperpanjangliniproduknyadiluarkisarannyasaatini
  • Pengisianlini, yaknimenambahkanlebihbanyakbarangdalamkisaransaatini
perpanjangan lini line stretching
PerpanjanganLini (Line Stretching)
  • PerpanjangankeBawahPasar
  • PerpanjangankeAtasPasar
  • PerpanjangankeDuaArah

Contoh:GAPmenciptakan

merkOld Navyuntukproduk

denganhargalebihmurah.

Contoh:Toyota menciptakanmerkLexus untukprodukmobilkelasatas.

Contoh: Perusahaan anggurRobert MondaviMinerymenjual 3 macamanggur:

AnggurNew Worldseharga $35

AnggurMondavi Reserve seharga $85

AnggurWoodbridgeseharga $11

pengisian lini line filling
PengisianLini (Line Filling)
  • Motif pengisianlini (line filling) adalah:
  • Menghasilkanlabatambahan
  • Memuaskankeluhanatasbanyaknyaprodukhilang
  • Berusahamenggunakankelebihankapasitas
  • Berusahamenjadiperusahaanlinipenuhterkemuka
  • Berusahamenamballubanguntukmenyingkirkanpesaing
  • BerlebihanapabilamengakibatkanKanibalisasiProdukdankebingunganPelanggan
co branding
Co Branding
  • Pemasarseringmenggabungkanprodukmerekadenganprodukdariperusahaan lain denganberbagaicara
  • Co Branding: Duaataulebihmerekterkenaldigabungkanmenjadisatuprodukbersamaataudipasarkanbersamadalambeberapacara
  • Kelebihanutama Co Branding:
    • Produkdapatdiposisikansecarameyakinkanmelaluikelebihanberbagaimereklainnya
    • Membukapeluangtambahanbagikonsumendansaluranbaru
    • Mampumengurangibiayapeluncuranproduk
    • Saranaberhargauntukmempelajarikonsumendanbagaimanaperusahaan lain mendekatimereka
pengemasan pelabelan jaminan garansi
Pengemasan, Pelabelan, Jaminan & Garansi
  • Pengemasan:Semuakegiatanmerancangdanmemproduksiwadahuntuksebuahproduk
  • Pelabelan: namamerekdansejumlahinformasiuntukmengidentifikasikanproduk, memperingkatproduk, menggambarkanprodukataumempromosikannya
  • Jaminan: PernyataanResmikinerjaproduk yang diharapkanolehprodusen
  • Garansi: Pernyataan yang digunakanuntukmengurangiresikoanggapanpembeli
ad