slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
PowerPoint Presentation
Download Presentation

Loading in 2 Seconds...

play fullscreen
1 / 1

- PowerPoint PPT Presentation

  • Uploaded on

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

RANCANG BANGUN SISTEM INFORMASI PENJUALAN BERBASIS WEB PADA UD. RUKUN MAKMURFerry Ferdian1)1) S1/ Jurusan Sistem Informasi. Sekolah Tinggi Manajemen Informatika & Teknik Komputer Surabayaemail : wakpey@yahoo.comAbstract : UD. Rukun Makmur is a shop specializing is sales of bicycle in Surabaya and is currently working to expand its business. With stores scattered in Surabaya not enough to reach consumers outside the region and outside the island. To reach areas outside Surabaya, set up shop will cost a lot and also needs of labor costs more too. Others obstacles that arise with the establishment of large stores is the capacity of the store used to hold and display product stock is limited. based on the above description, it is necessary to created a system of web-based sales information system that can help business owners UD. Rukun Makmur to expand its product marketing areas. Owners do not need to drain a lot of money to fund additional staff, enough to cover one person to administer or admin to maintenance website. Website that allows the store to display more product than the capacity to set up shop.Keyword :Sales Information System, BicycleLANDASAN TEORILatar BelakangUD. RukunMakmurmerupakantoko yang bergerakdibidangpenjualansepeda yang beradadi Surabaya dansaatiniberupayauntukmengembangkanusahanya. Dengantoko yang beradadi Surabaya belumcukupuntukmenjangkaukonsumen-konsumen yang adadiluardaerahmaupundiluarpulau. Untukmenjangkaudaerah yang adadiluar Surabaya, mendirikantokoakanmembutuhkanbiaya yang banyakdanjugakebutuhanbiayatenagakerjasemakinbanyak pula. Permasalahaninimerupakankendala yang umumnyaberpengaruhterhadapmeningkatnyaomset yang dihasilkantoko.Kesulitanpelangganuntukmemperolehinformasimengenai data produkmerupakansalahsatukendala yang dihadapiselamapenggunaansistemkonvensional. Untukmelihatinformasimengenaiproduk yang dibutuhkan, pelangganharusdatangketokountukmengetahuiinformasisecaramendetail. inimenyebabkanbanyakwaktuterbuang yang dibutuhkanpelangganuntukmemperolehinformasi. Selainituuntukmelakukanpembelian, pelangganjugadipersulitdengantidakadanyasistem yang mempermudahpelangganuntukmelakukanpembelianselaindengandatanglangsungketoko. Kendalasepertiiniakanberdampakpadaberkurangnyaniatpelangganuntukmelakukantransaksi.Jangkauanpasar yang sempitjugamerupakankendala yang dihadapipihaktoko. Dengantoko yang beradadi Surabaya tidakcukupuntukmenjangkaudaerah-daerah yang adadiluardaerahmaupundiluarpulau. Untukmeningkatkanomsetpenjualanpihaktokoharusmemikirkanbagaimanacarauntukmendirikansebuahsistem yang dapatmenyetaraisolusimendirikantokodiluardaerahmaupunluarpulau. Sistem yang dibuatharusjauhlebihmurahdibandingkandenganmendirikantokodiluardaerahmaupunluarpulau.Denganperancanganuntukmembukatokobarutentunyamemerlukantambahantenaga yang banyakuntukdirekrutmenjadipegawai. Selainitudenganpenambahantokotentunyamembutuhkanbiayatambahanuntukoperasionalperawatangedung. Makadariitudiperlukansebuahperancangansistem yang matang agar bisameminimalkanbiayauntukpendanaankaryawandanperawatangedung.PenjualanKonseppenjualanadalahgagasanbahwakonsumentidakakanmembelicukupbanyakprodukperusahaankecualijikaperusahaantersebutmelakukanusahapenjualandanpromosidalamskalabesar.MenurutKotler (2006:457), penjualanmerupakansebuahprosesdimanakebutuhanpembelidankebutuhanpenjualandipenuhi, melaluiantarpertukaraninformasidankepentingan. Jadikonseppenualanadalahcarauntukmempengaruhikonsumenuntukmembeliproduk yang ditawarkan. Dalamkenyataannyapenjualanmempunyaiduasistem yang biasaditerapkanolehsuatuperusahaandagangyaitupenjualan yang dilakukandengancaratunaidanpenjualan yang dilakukanmenggunakancarakreditatauseringdisebutcaraangsuran.Penjualan yang dilakukansecaratunaimerupakanpenjualandimanasaatterjadipenjualanpembeliakanmembayarhargabarangataujasa yang dibelinyasaatitujuga. Penjualan yang dilakukansecarakreditatauangsuranadalahbilamanapembayaranbaruditerimabeberapawaktukemudiansetelahterjadinyatransaksipenjualandancarapembayarannyadapatdilakukansecarabertahapdenganjumlahtertentudandalamjangkawaktutertentu pula.Pentingnyapromosipenjualankarenapromosipenjualanadalahkegiatan-kegiatanpemasaranselainpersonal selling, periklanandanpublisitas, yang mendorongevektifitaspembeliankonsumendanpedagangdenganmenggunakanalatperagaan, pameran, demonstrasi, dansebagainya yang ditunjukkanuntukmeningkatkanpenjualanbarangtertentu. 2.2 E-Commerce Menurut Williams dan Sawyer (2007:436), Electronic commerce (e-commerce) adalahperdaganganataupenjualandanpembelianprodukdanataujasamelaluijaringan internet. E-commerce telahmengubahbisnismenjadi online, tidakhanyamemperluaspilihanprodukdanjasabagikonsumen, tetapijugamembentukpeluangbisnisbarudanmemperkuatbisnis yang telahadauntukmengembangkanstrategidengan internet. E-commerce membentukkembalikeseluruhan industry danmengubahhal yang paling mendasardarisebuahperusahaan.Terdapattigamacamsisteme-commerce yang utamayaitu:1. Sistem Business to BusinessSistembusiness to business (B2B) adalahpenjualanataupertukaranbarangdanjasasecaraelektronikdanlangsungantarperusahaansehinggadapatmemangkasbiayaperantara. Dalamsistem B2B sebuahbisnismenjualkebisnis yang lain denganmenggunakan internet ataujaringankhusus yang bertujuanuntukmemangkasbiayatransaksidanmeningkatkanefisiensi. Selainmenjualproduk, sisteminijugadapatmenjualiklan, pelatihanpegawai, risetpasar, dukunganteknis, layananperbankan, danlayanandukunganbisnislainnya. B2B kebanyakanmenggunakanjalurkomunikasikomersial, namunsekarangbanyakbisnis B2B menggunakan internet, extranet, danataujaringanpribadi virtual. 2. SistemBusiness to ConsumerSistembusiness to consumer (B2C) adalahsisteme-commercedimanaperusahaanmenjualbarangataujasakepadakonsumen. Sisteminipadadasarnyamenggeserkaryawandiposisipenyeliadanbahkan took fisik (bricks and mortar). Contohsistem B2C adalah, danbanyaklembagakeuangansertapemerintah AS.3. SistemConsumer to ConsumerSistemconsumer to consumer (C2C) adalahsisteme-commerce dimanakonsumenmenjualbarangataujasasecaralangsungkekonsumen lain, kerap kali denganbantuanpihakketiga (perusahaanlelang online). Pihakketigamenjadiperantaraatau mediator antarakonsumen yang inginmembelidanmenjual, danmerekamengambilsebagiankecildarikeuntunganpenjual.WebsiteWebsiteadalahsebutanuntuksekelompokhalamanweb (web page), yang padaumumnyamerupakanbagiandarisuatunama domain atau sub domain diWorld Wide Web di Internet. WWW terdiridariseluruhsitusweb yang tersediakepada public. Halaman-halamansebuahsitusweb diaksesdarisebuah URL yang menjadiakar (root), disebutdenganhomepage (halamanindukatauhalamanmuka) danpadaumumnyadisimpanpada server yang sama. Sebuahwebsitebiasanyadibuatoleh individual, bisnisatauorganisasiberdasarkan topic dantujuantertentu. Setiapwebsite dapatjugaberisihyperlink ke websitelainnya, jadiantarasatuwesitedenganwebsite lainnyadapatsalingberhubungan. Website ditulisataudirubahsecaradinamismenjadi HTML (Hyper Text Markup Language) dandiaksesdenganmenggunakan software yang disebutInternet Browser yang dikenaljugadengansebutan HTTP client. Web pagedapatdiaksesdandilihatdariberbagaimacamalat, diantaranyadesktop computer, laptop computer, PDA ataupuncell phone yang semuanyamempunyaikoneksi internet. Sebuahwebsite ditampungdalamsebuahsistem computer yang disebutweb-server, dikenaljugadengansebutan HTTP server. Server inimenggunakan software yang berfungsidanmengirimresponweb page terhadapperintah yang dilakukanolehpengakseswebsite.Adaduajeniswebsite yang adasaatini, yaituStatic Website danDynamic Website. Dua-duanyamemilikikelebihandankekuranganmasing-masing. DibawahiniakandijelaskanbeberapapengertiandariStatic Website danDynamic Website.Static website (Website Statis) adalah website yang isinyadirancanguntukseringberubahsecara manual, danbiasanyadikelolaperorangandenganmenggunakanbeberapasoftware editor.Dynamic Website (Website Dinamis) adalahwebsite yang isinyadaninformasinyadirancanguntukseringberubah. Ketikaweb-server menerimaperintahuntukmenampilkansesuatudalamweb-page, makaweb-pageakansecaraotomatisdigerakkanolehsoftware yang dipakaiuntuksegerameresponperintahtersebut, contohnya: website dapatmenampilkan status dialog antar user, memonitorsituasi yang terjadiataumenyediakaninformasi yang dimintaoleh individual user. Beberapasistem software yang dapatdigunakanuntukenunjangdalampembuatanDynamic Website antara lain : PHP, ASP.NET dan JSP.SistemSistemmerupakankumpulandariobjek-objeksepertimanusia, sumberdaya, konsepdanproseduruntukmelakukansuatufungsiatautujuan. Sistemterbagimenjaditigabagianyaitu input, prosesdan output. Bagian-bagiantersebutdikelilingiolehdanselalumeliputimekanismeumpanbalik. Sebagaicontoh, pengambilkeputusanmanusiadapatdikategorikansebagaisebuahsistem. SistemInformasiSisteminformasididefinisikanoleh Robert A. Leitchdan K. Roscoe Davis sebagaiberikut, “Sisteminformasiadalahsuatusistemdidalamsuatuorganisasi yang mempertemukankebutuhanpengolahantransaksiharian, mendukungoperasi, bersifatmanajerialdankegiatanstrategidarisuatuorganisasidanmenyediakanpihakluartertentudenganlaporan-laporan yang diperlukan”.Sisteminformasiterdiridaribeberapakomponen yang disebutdenganistilahblokbangunan (building block). Block bangunantersebutadalah:1. Blok masukan (input block)MasukanatauInputmewakili data yang masukkedalamsisteminformasi. Masukandisinitermasukmetode-metodedan media untukmenangkap data yang akandimasukkan, yang dapatberupadokumen-dokumendasar.2. Blok model (model block)Blok initerdiridarikombinasiprosedur, logikadan model matematik yang akanmemanipulasi data input dan data yang tersimpandi basis data dengancara yang sudahditentukanuntukmenghasilkankeluaran yang diinginkan.3. Blok keluaran (output block)Produkdarisisteminformasiadalahkeluaran yang merupakaninformasi yang berkualitasdandokumentasi yang bergunauntuksemuatingkatanmanajemensertasemuapemakaisistem.4. Blok teknologi (technology block)Teknologimerupakan “kotakalat” (toolbox) dalamsisteminformasi. Teknologidigunakanuntukmenerima input, menjalankan model, menyimpandanmengakses data, menghasilkandanmengirimkankeluarandanmembantupengendaliandarisistemsecarakeseluruhan.5. Blok basis data (database block)Basis data (database) merupakankumpulandari data yang salingberhubungansatudenganlainnya, tersimpandiperangkatkeraskomputerdandigunakanperangkatlunakuntukmemanipulasinya. Data perludisimpandidalam basis data untukkeperluanpenyediaaninformasilebihlanjut. Data didalam basis data perludiorganisasikansedemikianrupa, supayainformasi yang dihasilkanberkualitas. Organisasi basis data yang baikjugabergunauntukefisiensikapasitaspenyimpannya. Basis data diaksesataudimanipulasidenganmenggunakanperangkatlunakpaket yang disebutdengan DBMS (Database Management Systems).6. Block kendali (control block)Banyakhal yang dapatmerusaksisteminformasi, sepertimisalnyabencanaalam, api, temperatur, air, debu, kecurangan-kecurangan, kegagalan-kegagalansistemitusendiri, kesalahan-kesalahan, ketidak-efisienan, sabotase, dan lain sebagainya. Beberapapengendalianperludirancangdanditerapkanuntukmeyakinkanbahwahal-hal yang dapatmerusaksistemdapatdicegahataupunbilaterlanjurterjadikesalahan-kesalahandapatlangsungdiatasi.KonsepDasarSistemInformasiSistemmerupakankumpulanelemen-elemendanbekerjasamauntukmemprosesmasukanatau input yang ditujukankepadasistemtersebutdanmengolah input tersebutsampaimenghasilkankeluaranatau output yang diinginkan. Sedangkaninformasiadalahkumpilan data yang diolahmenjadibentuk yang lebihbergunadanlebihberartiataudalamkata lain lebihbermanfaatbagipenggunainformasitersebut.Informasimerupakansuatukumpulan data yang sudahdiprosesuntukmemperolehpengetahuan yang lebihbergunauntukmencapaisuatusasaran. Suatuinformasidapatdikatakanbernilaiapabilainformasitersebutmemberikansuatumanfaat yang lebih disbanding dengankitahanyamelihat data yang ada. Suatusistemmempunyaitujuanatausasaran. Tujuanbiasanyadihubungkandenganruanglingkup yang lebihluasdansasarandalamruanglingkup yang lebihsempit. Sasarandarisistemsangatmenentukanmasukan yang dibutuhkansistemdankeluaran yang dihasilkanolehsistem. Sistemdapatdikatakanberhasilapabilajikadapatmencapaitujuanatausasaran.Suatuinformasidikatakanbernilaiapabilamemilikimanfaat yang lebihefektifdanefisienjikadibandingkandenganbiayauntukmendapatkannya. Informasidapatdihasilkandarisisteminformasi yang disebutjugaprocessing system atauinformation processing system ataujugainformation generation system.Sisteminformasiadalah “Suatukombinasidariorang-orang, fasilitas, teknologi, media, prosedur-prosedurdanpengendalian yang ditujukanuntukmendapatkanjalurkomunikasipenting, memprosestiperutintertentu, member sinyalkepadamanajemendanlainnyaterhadapkejadian-kejadian internal daneksternal yang pentingmenyediakansuatudasaruntukpengambilankeputusan yang cerdik”.MenurutHerlambang (2005:47), sisteminformasiterdiridariinput, prosesdanoutput. Padaprosesterdapathubungan timbale balikdenganduaelemen, yaitu control darikinerjasistemdansumber-sumberpenyimpanan data. Input yang akandiprosesberupa data, baikberupakarakter-karakterhurufmaupunnumerik. Saatini data dapatberupasuaraatauaudio maupungambaratauvideo. Data inidiprosesdenganmetode-metodetertentudanakanmenghasilkan output yang berupainformasi. Informasi yang dihasilkandapatberupalaporanataureport maupunsolusidariproses yang telahdijalankan. Basis Data MenurutNugroho (2004:4), basis data ataudatabase merupakankoleksidari data-data yang terorganisirdenganrapisehinggadapatdenganmudahdisimpandandimanipulasi (ditambah, diubah, dihapus, dandicari). Database merupakankomponen yang sangatpentingdalamkehidupansehari-hari. Kita dapatmenjumpaipemanfaatandatabase dalamkehidupansehari-hari, sepertipenggunaanmesin ATM, sistemakademikdisekolah, sisteminformasidikantor, dll. Sebenarnyadatabase tidaklahharusberhubungandengan computer, catatanbelanjaseorangiburumahtanggajugamerupakandatabasedalambentuk yang sangatsederhana.Salahsatutujuandaridatabase adalahmemberikanpenggunasuatupandanganabstrakdari data, yaitusistemmenyembunyikanrincianbagaimana data disimpandandipelihara. Sistemdatabase harusdibuatsemudahmungkinuntukdimengertikarenakebanyakanpenggunasistemdatabaseadalahorang-orang yang kurangterlatihdibidangteknologikomputer. Pengembangsistemdatabase harusnyadapatmenyembunyikankompleksitassuatusistemdenganmenyediakanbeberapaperingkatabstraksi. Beberapaperingkatabstraksiituadalah:PeringkatFisikyaituperingkatterendahdarisuatuabstraksi yang mendeskripsikanbagaimana data sesungguhnyadisimpandalam media penyimpananfisik, sepertihardisk, pita magnetic dansebagainya.Peringkatlogikayaituperingkat yang mendeskripsikan data apa yang disimpandidatabase danhubunganapa yang adaantara data-data tersebut. Peringkatlogikamenjelaskandatabase denganstruktur yang relative sederhana, meskipunimplementasinyamungkinmengandungstrukurfisik yang kompleks.PeringkatPenggunayaituperingkattertinggidariabstraksi. Meskipunperingkatlogikasudahcukupsederhana, namunpadadatabase yang berukuranbesar, kompleksitasmasihdijumpaikarenabanyaknyajenis data daninformasi yang tersimpanpadadatabase. Kebanyakanpenggunatidakmembutuhkaninformasiitu, merekakebanyakanmengaksesbagiantertentudaridatabase. Peringkatpengguna yang seringdijumpaiadalah GUI (Graphichal User Interface). SebagaicontohdapatdilihatpadaGambar2.1berikut yang menjelaskantigaperingkatabstraksi dataGambar 1.TigaPeringkatAbstraksi DataANALISA PERANCANGAN SISTEMDokumen Flow Transaksi PenjualanDokumen flow adalah sebuah model yang disusun sesuai dengan proses bisnis yang ada yang akan dibangun menjadi sebuah sistem yang baru. Dokumen flow ini akan digunakan oleh analis sistem untuk memahami proses bisnis dan aliran dokumen yang ada untuk kemudian dianalisa dan dirancang kembali sistem yang akan digunakan.Pada dokumen flow dibawah ini menjelaskan bagaimana alur proses penjualan. Proses diawali dengan pencarian produk pada gudang untuk didisplay pada toko. Setelah itu maka akan keluar produk yang dipilih untuk didisplay beserta katalog produk yang tersedia. Proses selanjutnya yaitu didisplay produk pada toko agar dapat dilihat oleh pembeli. Apabila setelah melihat didisplay produk pembeli berminat dengan produk yang ditampilkan, maka dilanjutkan pemesanan produk oleh pembeli, kemudian karyawan toko membuat nota penjualan yang nantinya diserahkan kepada pembeli. Data produk yang keluar dicatat secara manual oleh karyawan toko. Laporan transaksi berupa nota penjualan akan digunakan sebagai bukti transaksi sebagai pertanggung jawaban karyawan terhadap produk yang berhasil dijual kepada pemilik toko. Setelah melakukan pembuatan nota penjualan, maka produk yang dipesan diserahkan kepada pelanggan beserta nota penjualan. Dari hasil transaksi penjualan pemilik toko akan melihat laporan penjualan yang nantinya akan digunakan untuk menentukan keputusan penjualan berikutnya. Gambar 2. Dokumen Flow Transaksi PenjualanDokumen Flow Terkomputerisasi Proses Transaksi PenjualanPada dokumen flow terkomputerisasi proses transaksi penjualan menggambarkan dua entity, yaitu entity pelanggan dan sistem penjualan. Proses transaksi penjualan dimulai dari pelanggan melakukan login ke sistem. Kemudian sistem akan mengecek apakah sudah terdaftar sebagai member apa belum. Jika belum terdaftar maka pelanggan melanjutkan ke proses registrasi pelanggan. Apabila pelanggan yang sudah terdaftarakan melakukan transaksi pembelian maka pelanggan akan memilih produk yang didisplay pada halaman website.Gambar3.Dokumen Flow Terkomputerisasi Transaksi PenjualanContext DiagramContext diagram dari sistem informasi ini seperti digambarkan pada gambar di bawah ini.Gambar4. Context DiagramDari context diagram diatasmakadi break downke level 0 untukmelihatproseslebih detail lagisepertigambardibawahini :Gambar5. DFD Level 0Conceptual Data ModelSebuahConceptual Data Modelmenggambarkansecarakeseluruhankonsepstruktur basis data yang dirancanguntuksuatu program atauaplikasi.Gambar6. CDM Hasil dan PembahasanPendaftaran CustomerPendaftaran customer dengan meninputkan email, password, konfirmasi password, nama, alamat, kota, telp, dan kodepos kemudian daftar..Gambar 7. Proses Registrasi UserPemesanan ProdukGambar 8. Proses Pemesanan ProdukKeranjang BelanjaKesimpulanSetelah dilakukan analisis, perancangan dan pembuatan Rancang Bangun Sistem Informasi Penjualan Berbasis Web Pada UD. Rukun Makmur, maka dapat diambil kesimpulan sebagai berikut :Sistem informasi penjualan berbasis web ini diharapkan dapat membantu dalam proses pemasaran dan penjualan produk sepeda.Aplikasi sistem Informasi penjualan yang menangani pelaporan transaksi penjualan, pelaporan detil transaksi penjualan pada periode tertentu.Saran Website ini tentunya dapat dikembangkan ke tahapan yang lebih terperinci. Halaman produk yang terdapat pada aplikasi web ini kemungkinan dapat dimodifikasi agar menjadi katalog produk online secara dinamis. Selain itu fitur-fitur visual dalam web ini juga dapat dikembangkan lebih baik nantinya. Daftar PustakaHerlambang, Soendoro & Tanuwijaya, Haryanto. 2005. SistemInformasi: Konsep, Teknologi & Manajemen. Yogyakarta: GrahaIlmu.Jogiyanto. 2005. Analisis & DesainSistemInformasi: PendekatanTerstruktur, TeoridanPraktikAplikasiBisnis. Yogyakarta: Andi OffsetKristanto, Andri. PerancanganSistemInformasidanAplikasinya. Yogyakarta: Gave MediaKotler dan Amstrong, 2006, Prinsip-Prinsip Pemasaran Edisi 12 Jilid 1, Penerbit Erlangga, Jakarta.Nugroho, Adi. 2004. KonsepPengembanganSistem Basis Data. Bandung: InformatikaWilliams, Brian K & Sawyer, Stacey C. 2007. Using Information Technology: a Practical Introduction to Computers & Communications. Yogyakarta: Andi Offset Sutabri, Tata. 2004, AnalisaSistemInformasi. Andi, Yogyakarta