protein structure modeling
Download
Skip this Video
Download Presentation
Protein structure modeling

Loading in 2 Seconds...

play fullscreen
1 / 6

Protein structure modeling - PowerPoint PPT Presentation


  • 118 Views
  • Uploaded on

Protein structure modeling. June 4, 2002 Quiz#4 Writing Assignments-Average=80/100 Homework Correction on Quiz #2 answer Learning objectives-Learn how to use Deep View to create models of proteins-human and hen lysozyme. Quiz #2 CORRECTION. M E Q V L I V C - -

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Protein structure modeling' - keola


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
protein structure modeling
Protein structure modeling
  • June 4, 2002
  • Quiz#4
  • Writing Assignments-Average=80/100
  • Homework
  • Correction on Quiz #2 answer
  • Learning objectives-Learn how to use Deep View to create models of proteins-human and hen lysozyme.
quiz 2 correction
Quiz #2 CORRECTION

M E Q V L I V C - -

M E E - - I V C N D

PATH SCORES 5 4 3 3 2 1

SIM SCORES 5 5 2-4 0 4 4 9-4 0

GAP EXT PEN -1-1 -1-1

PATH SCORE TOTAL=18

SIMILARITY SCORE TOTAL=17

homework 17
Homework #17

Conf: 987644588777886268899874177645567666752132024612455531345666

Pred: CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHCCCCCC

AA: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP

10 20 30 40 50 60

Conf: 433467778865688888888878786878788888788887665640588862378652

Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCC

AA: DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK

70 80 90 100 110 120

Conf: 266631631344344201446568996377667844788762044167889987378865

Pred: EEEEECCCCHHHHHHHCCCCCCEEEEECCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCC

AA: SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE

130 140 150 160 170 180

Conf: 578888887755136641466531002578851589851479977641565666653134

Pred: CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCCHHHHHHHHHHHCC

AA: RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS

190 200 210 220 230 240

Conf: 445888763068999980899845301048999844798653024665421478887788

Pred: CCCCCCCCCCEEEEEEEECCCCCEEECCEEEEEEECCCCCCCHHHHHHHHCCCCCCCCCC

AA: SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP. . .

250 260 270 280 290 300

slide4
HELIX 1 1 SER A 166 HIS A 168 5 1TSR 168

HELIX 2 2 PRO A 177 GLU A 180 1 1TSR 169

HELIX 3 3 PRO A 278 GLU A 287 1 1TSR 170

HELIX 4 4 GLN B 167 THR B 170 5 1TSR 171

HELIX 5 5 PRO B 177 ARG B 181 1 1TSR 172

HELIX 6 6 PRO B 278 GLU B 287 1 1TSR 173

HELIX 7 7 GLY C 105 TYR C 107 5 1TSR 174

HELIX 8 8 SER C 166 MET C 169 1 1TSR 175

HELIX 9 9 PRO C 177 ARG C 181 1 1TSR 176

HELIX 10 10 PRO C 278 GLU C 285 1 1TSR 177

SHEET 1 A 4 ARG A 110 GLY A 112 0 1TSR 178

SHEET 2 A 4 CYS A 141 TRP A 146 -1 N TRP A 146 O ARG A 110 1TSR 179

SHEET 3 A 4 THR A 230 TYR A 236 -1 N TYR A 234 O CYS A 141 1TSR 180

SHEET 4 A 4 ILE A 195 GLU A 198 -1 N GLU A 198 O HIS A 233 1TSR 181

SHEET 1 B 7 CYS A 124 SER A 127 0 1TSR 182

SHEET 2 B 7 LYS A 132 CYS A 135 -1 N PHE A 134 O THR A 125 1TSR 183

SHEET 3 B 7 LEU A 264 VAL A 274 1 N GLU A 271 O MET A 133 1TSR 184

SHEET 4 B 7 ILE A 251 GLU A 258 -1 N LEU A 257 O LEU A 265 1TSR 185

SHEET 5 B 7 ARG A 156 TYR A 163 -1 N ILE A 162 O LEU A 252 1TSR 186

SHEET 6 B 7 HIS A 214 PRO A 219 -1 N VAL A 218 O VAL A 157 1TSR 187

SHEET 7 B 7 GLU A 204 ASP A 207 -1 N LEU A 206 O SER A 215 1TSR 188

SHEET 1 C 4 ARG B 110 GLY B 112 0 1TSR 189

SHEET 2 C 4 CYS B 141 TRP B 146 -1 N TRP B 146 O ARG B 110 1TSR 190

SHEET 3 C 4 THR B 230 TYR B 236 -1 N TYR B 234 O CYS B 141 1TSR 191

SHEET 4 C 4 ILE B 195 GLU B 198 -1 N GLU B 198 O HIS B 233 1TSR 192

SHEET 1 D 7 CYS B 124 SER B 127 0 1TSR 193

SHEET 2 D 7 LYS B 132 CYS B 135 -1 N PHE B 134 O THR B 125 1TSR 194

SHEET 3 D 7 LEU B 264 VAL B 274 1 N GLU B 271 O MET B 133 1TSR 195

SHEET 4 D 7 ILE B 251 GLU B 258 -1 N LEU B 257 O LEU B 265 1TSR 196

SHEET 5 D 7 ARG B 156 TYR B 163 -1 N ILE B 162 O LEU B 252 1TSR 197

SHEET 6 D 7 HIS B 214 PRO B 219 -1 N VAL B 218 O VAL B 157 1TSR 198

SHEET 7 D 7 GLU B 204 ASP B 207 -1 N LEU B 206 O SER B 215 1TSR 199

SHEET 1 E 4 ARG C 110 PHE C 113 0 1TSR 200

SHEET 2 E 4 CYS C 141 TRP C 146 -1 N TRP C 146 O ARG C 110 1TSR 201

SHEET 3 E 4 THR C 230 TYR C 236 -1 N TYR C 234 O CYS C 141 1TSR 202

SHEET 4 E 4 ILE C 195 VAL C 197 -1 N ARG C 196 O ASN C 235 1TSR 203

SHEET 1 F 7 THR C 125 SER C 127 0 1TSR 204

SHEET 2 F 7 LYS C 132 GLN C 136 -1 N PHE C 134 O THR C 125 1TSR 205

SHEET 3 F 7 LEU C 264 CYS C 275 1 N GLU C 271 O MET C 133 1TSR 206

SHEET 4 F 7 ILE C 251 GLU C 258 -1 N LEU C 257 O LEU C 265 1TSR 207

SHEET 5 F 7 ARG C 156 TYR C 163 -1 N ILE C 162 O LEU C 252 1TSR 208

SHEET 6 F 7 HIS C 214 PRO C 219 -1 N VAL C 218 O VAL C 157 1TSR 209

SHEET 7 F 7 GLU C 204 ASP C 207 -1 N LEU C 206 O SER C 215 1TSR 210

answers to hw 17
Answers to HW#17

Using polypeptide A we get the following

percentage of correct assignments: 5/14 x 100 = 36%

Using non-overlapping structure assignments

of polypeptides A,B and C we get the following

percentage of correct assignments: 33/55 X 100 = 60%

Assuming coil (C) for areas not assigned in

crystal structure (PDB) between aa 105 and aa 287 we get the following percentage of correct assignments:

116/184 X 100 = 63%

tertiary structure modeling
Tertiary structure modeling
  • Use hen lysozyme as a template to create human lysozyme structure model
ad