slide1
Download
Skip this Video
Download Presentation
Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA

Loading in 2 Seconds...

play fullscreen
1 / 106

Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA - PowerPoint PPT Presentation


  • 323 Views
  • Uploaded on

PENCATATAN DALAM SISTEM NERACA NASIONAL. Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA. Siklus Proses Produksi. Enterpreneur (Management) Organization and Development of Other Three Factors. Land Natural Resources. Production Goods and Services. Capital

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA' - kenyon-mcpherson


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide1
PENCATATAN DALAM SISTEM NERACA NASIONAL

Bahan Perkuliahan SNN-PDB

SEKOLAH TINGGI ILMU STATISTIK – JAKARTA

siklus proses produksi
Siklus Proses Produksi

Enterpreneur

(Management)

Organization and

Development of

Other Three Factors

Land

Natural

Resources

Production

Goods and

Services

Capital

Machinery,

Factories

Labor

Human Efforts

And Skills

kompensasi atas faktor produksi
Merupakan sumber daya alam yang paling dasar
  • “Sewa tanah”
  • harga atas peng-gunaan tanah
  • penghargaan yang diterima oleh pemilik atas keterlibatannya dalam proses produksi

“Tanah”

Merupakan faktor produksi terpenting

“Upah dan gaji”

- penerimaan pekerja atas kontribusinya dalam berbagai proses produksi

“Tenaga kerja”

faktor produksi yang dibuat manusia dari sumber daya alam

“Bunga”

- Termasuk penerimaan atas faktor kepemilikan kapital (deviden,royalti & properti lainnya)

“Kapital”

“Keahlian/

Kewira-usahaan”

“Keuntungan”

penerimaan “keuntungan” wira usaha atas layanan serta resiko usahanya, bahkan kemungkinan kehilangan bisnisnya (rugi)

Manajemen

Kompensasi Atas Faktor Produksi
arus siklus dari pendapatan
Rumahtangga

Pengeluaran

rumahtangga

Pengeluaran rumahtangga (Output)

Pemerintah

Perantara keuangan

Rest of the world

Pendapatan rumahtangga (Input)

Perusahaan

Arus Siklus dari Pendapatan

ke faktor

Pembayaran

proses pencatatan dalam snn
SISTEM

NERACA

NASIONAL

SISTEM

PENCATATAN

TRANSAKSI

TRANSAKSI

EKONOMI

TINDAKAN

EKONOMI

PELAKU

EKONOMI

ARUS

EKONOMI

  • Moneter & non
  • moneter (barter)
  • Pasar & non pasar
  • Dengan & tanpa
  • pihak lain
  • Motif ekonomi
  • Resiko ekonomi
  • Neraca ber- jalan
  • Neraca aku- mulasi
  • Neraca akhir tahun
  • Cakupan
  • Acrual & cash/ tunai
  • Pencatatan ganda & quadraple
  • Penilaian &
  • penyesuaian

KLASIFIKASI

  • Perubahan :
  • Harga
  • volume
  • Perilaku
  • Jenis institusi
  • Unit Institusi

ARUS

LAINNYA

PENGARUH

NON MANUSIA

TINDAKAN

NON EKONOMI

  • Gempa bumi
  • Banjir
  • Motif non ekonomi/sosial
  • Resiko non ekonomi/sosial

Lainnya :

peristiwa politik

Proses Pencatatan Dalam SNN

TINDAKAN MANUSIA

perangkat data snn indonesia
Domestik

(Internal Acc)

ROW

(External Acc)

Tabel I-O

Ekspor/

Impor

PDB

Tabel S-U

Factor Income

SNSE

Current Transfer

Matrik

PMTB

Capital Transfer

NAD

Pinjaman

Perangkat Data SNN Indonesia

Neraca B & J

Neraca Prod.

Neraca P P

Neraca K

Neraca F

B/S

B/S

akhir

awal

output data nasional
N.Lingkungan

SNNI

Central framework

N.Pariwisata

SEAFA

Gender

PDB

Tabel I-O

Matriks

S & U

  • APC & MPC
  • ICOR & ICVAR
  • Stok Kapital
  • Labor Productivity

SAM

Lap.

Usaha

Penggunaan

NAD

Pendapatan

Output Data Nasional

Input data

- …

- …

PDB

N. Energi

prinsip pencatatan snni 5a
:

Pelaku ekonomi

Actors

:

Perilaku/aktivitas ekonomi

Activities

:

Arus/flows atau posisi/stocks

Actions

:

Keterkaitan

Accounts

Sistem pencatatan dgn

format neraca

:

Articulated

Prinsip Pencatatan SNNI – “5A”
slide10
Domestik

Rest of the Word

(Luar Negeri)

RT

LNPRT

Pemerintah

Korporasi

(Non-Residen)

(Residen)

Actors

(pelaku-pelaku ekonomi)

klasifikasi unit ekonomi
Klasifikasi Unit Ekonomi
  • Dua cara untuk mengklasifikasikan aktor ekonomi:
    • Unit Institusi  Sektor
    • Establishmen  Industri
  • Nasional
    • Neraca-neraca yang dikumpulkan dari unit institusi residen dikelompokkan ke dalam sektor dan sub-sektor
    • Tingkat propinsi dan kabupaten
unit institusi
Unit Institusi

Unit Institusi:

Entitasekonomi yang atasnamanyadapatmemilikiasetdankewajiban, terlibatdalamaktivitasekonomi, danbertransaksidenganentitas lain

Karakteristik:

  • Berhakmemilikibarangdanaset, sehinggadapatmelakukanpertukaranmelaluiaktivitastransaksidengan unit institusi lain
  • Dapatmemutuskanuntukterlibatdalamaktivitasekonomi, sehinggabertanggungjawabdandapatmempertanggung-jawabkantindakanya di depanhukum
  • Hal di atasmenimbulkankewajiban, danatasnamanyadapatmelakukankomitmenatasdasarkepercayaanataukontrak formal
  • Memilikisatu set neracalengkap, ataucatatankeuangan yang memadaidarisudutekonomimaupunhukumgunadapatmenyusunneraca
unit institusi lanjutan1
Unit Institusi (lanjutan…)
  • Rumahtangga
    • Individurumahtanggaterdiridariindividuataukelompok individuyang tinggalbersamadalamsuatubangunantempattinggal. Secarabersamamerekamengelola pendapatandankekayaansertamengkonsumsi barang dan jasa utamanyakelompokmakanandanperumahan
    • Institusirumahtanggamerupakankelompok individuyang tinggal di rumah sakit, panti jompo, biara, dan tempatsejenisuntuk periode cukuplama. Secarakeseluruhanindividuataukelompokindividu yang ada diperlakukan sebagai satuunit
  • Entitas legal atau sosial
    • Entitasyang diakuiolehhukumataumasyarakat, dankeberadaanyaterpisahdari individu atau entitas lain yangmengendalikan. Entitasini bertanggung jawab atas tindakan ekonomi yang diambil meskipun otonominyadibatasi olehinstitusi lain. Entitasiniterdiridariunit korporasi, lembaga non-profit, danpemerintah
sektor institusi
SektorInstitusi: kumpulan unit yang mempunyaifungsi, tujuandanperilaku yang samadidalamperekonomianSektorInstitusi

SektorInstitusiterdiri:

  • Korporasi (Finansial & Non-finansial)
  • Unit Pemerintah
  • Lembaga Non-profit Pelayan RT/LNPRT
  • Rumahtangga
1 korporasi
Entitas legal yang menentukantujuankegiatandalammemproduksibarangdanjasauntukmemenuhipermintaanpasar, yang nantinyaakanmenjadisumberkeuntunganatauperolehanfinansial (gain) bagipemiliknya.
  • Merupakanusahakolektif yang dimilikiolehparapemegangsaham yang mempunyaiotoritasatauhakmengaturmanajemensecarakeseluruhan
1. Korporasi
1 korporasi lanjutan
Dibentuksecara legal (Terdaftar) sesuaidenganhukumnegarabersangkutan
  • Terlibatdalamproduksibarang-barangpasar
  • Kepemilikanberkaitandenganpemiliksahamsecarakolektif
  • Mempunyaisatu set neracasecaralengkap
  • Memilikiasetsendiri yang berbedadenganasetpemilik
  • Termasukkuasikorporatdankoperasi
1. Korporasi (lanjutan….)
1 korporasi lanjutan1
1. Korporasi (lanjutan….)
  • Mampumenghasilkanlaba/keuntunganfinansial lain untukpemilik
  • Diakuisebagaibadanhukumygterpisahdrpemilikygmenikmatilaba
  • Hanyaterlibatdalamproduksiuntukkeperluanpasar
2 unit pemerintah
Institusi yang didirikanmelaluiprosespolitikdanmemilikikekuasaandibidanglegislatif, eksekutifmaupunyudikatifatas unit-unit lainnya yang beradadisuatuwilayahtertentu.2. Unit Pemerintah
  • Establishment/ kel. Estab. pemerintahdenganproduksejenisdibawahmanajemenumumharusdiperlakukansebagaikorporasikuasibila:
    • Unit tsbmenetapkanharga output ygsignifikansecaraekonomi
    • Dikeloladandioperasikandgncaraserupakorporasi
    • Memilikisatu set neracalengkapsehinggadptdiukurdandiidentifikasisecaraterpisah
2 unit pemerintah lanjutan
2. Unit Pemerintah (lanjutan….)
  • Peranpemerintah(dibentukdari unit-unit pemerintahan)
    • Mengorganisir/mendanaiproduksibarang/jasa non-pasar
    • Jasa individual & kolektifuntukrumahtanggadankomunitas
    • Terlibatdalamdistribusi/redistribusipendapatandankekayaanmelaluiPerpajakandan transfer lain
3 unit lembaga non profit
3. Unit Lembaga Non-Profit

Merupakan entitas legal maupun sosial yang didirikan dengan tujuan untuk menghasilkan barang dan jasa yang bukan merupakan sumber bagi pendapatan, keuntungan atau perolehan finansialnya

Khususnya ditujukan bagi unit-unit kegiatan yang dibangun, dikontrol serta dibiayai oleh mereka sendiri

3 unit lembaga non profit lanjutan
3. Unit Lembaga Non-Profit (lanjutan…..)
  • Lembaga Non-profit yang MelayaniRumahTangga (LNPRT)
    • Entitas legal yang fungsiutamanyamemberikanjasa non-pasarkepadarumahtangga
    • Sumberdanautamaadalahdarisumbanganrumahtanggadaninstitusi lain
    • BagiandariLembaga Non-Profit (LNP), LNP lain yang melayanipemerintahdankorporasi
3 unit lembaga non profit lanjutan1
Org. formal informal ygdibentukolehperorangan, kel. masy, pemerintah, atauduniausahadalamrangkamenyediakanjasasosialkemasy., khususnyabagiangg. maupunkel. masy. tertentutanpaadanyamotivasimemperolehkeuntungan3. Unit Lembaga Non-Profit (lanjutan….)
4 rumahtangga
4. Rumahtangga
  • Individuataukelompokindividu yang tinggalbersamadalambangunantempattinggal, dimanamerekamengumpulkansebagianatauseluruhpendapatandankekayaansertamengkonsumsibarangdanjasasecarabersamaterutamamakanandanperumahan.
4 rumahtangga lanjutan
CakupanRumahTangga
    • Terdiridariorangataukumpulanorang yang masaksatudapur (pengaturanmakan yang sama)
    • Termasukusahatdkberbadanhukum
    • Pemasoktenagakerja; utamanyakonsumenakhir
    • Termasukaktivitasoperasionalrumahtangga
    • Termasuksektor informal
4. Rumahtangga (lanjutan….)
unit institusi residen
Unit InstitusiResiden
  • Suatuunit institusi menjadiresidensuatuwilayah ekonomi,jikamenjadipusat kepentingan ekonomi yang dominan di wilayahbersangkutan
  • Konsepresidendanwilayah ekonomi dirancangguna memastikan bahwa setiap unit institusi residenmasuk dalam satu wilayah ekonomi
  • Penggunaan wilayah ekonomi sebagai cakupanstatistikdapatdiartikanbahwasetiap anggota kelompok perusahaan afiliasi merupakanresiden perekonomian di mana diaberada, bukan berdasarkan lokasi keberadaankantorpusat
unit institusi residen lanjutan
Unit institusidiklasifikasikansebagaiResiden, jikahanyamempunyaipusatkepentinganekonomidinegaratersebutyang ditandaidengan
  • Lokasitempatproduksiberadadidalamnegara
  • Bermaksuduntukmelakukanaktivitasnyasecaraberkelanjutandenganjangkawaktu yang tidakterbatasatauterbatas (paling sedikit 1 tahun)
  • Untukindividu, adalahlokasirumahnyadanbukantempatdiabekerja
Unit InstitusiResiden (lanjutan…..)
unit institusi residen lanjutan1
Untukusahatidakberbadanhukum, residensamadenganpemilikusaha
  • Untukkorporasidanlembaga non-profit, tempatmerekamendaftarkanusaha (secarakonsitusi legal)
  • Pemiliktanahdanbangunanpadasuatunegara, selaluberadadinegaratersebut
  • Kedutaan, konsulatdankeberadaanestablismenmiliterdiluarnegeri, dianggapsebagairesiden
  • Lembagainternasional (PBB, dsj) adalahbukanresiden (non-residen)
Unit InstitusiResiden (lanjutan…..)
unit institusi residen lanjutan2
Unit InstitusiResiden (lanjutan…..)
  • PemegangasetdanTransaktor.
  • Korporasi and kuasikorporasi
    • Non-finansial
    • Finansial
  • PemerintahanUmum
  • Rumahtanggadanusaharumahtanggatidakberbadanhukum
  • Lembagaswasta non-profit yang melayanirumahtangga

-----------------------------

  • LuarNegeri
enterprise
Unit-unit institusi yang terlibatdalamkegiatanprosesproduksi, seperti:
    • Korporasi
    • Institusi non-profit
    • Usaha bukan-korporasi
  • Secarasimultanberarti
    • Terlibatdalamkegiatanproduksi yang berbeda-beda
    • Menghasilkanberbagaimacam/jenisprodukbarangdanjasa
Enterprise
enterprise dan establisment
Enterprise danEstablisment
  • Data yang diperolehdarisuatuestablismenmeliputi:
  • Item dalam neraca produksi dan neraca pendapatan yang diciptakan;
  • Data jumlahdan jenispekerja, sertajam kerjanya;
  • Perkiraan stok modal non-finansial, dan sumber daya alam yang digunakan;
  • Perkiraan perubahan stokdan PMTB yang dilakukan
industri
Industri
  • Kelompokbeberapaestablismenygterlibatdalamkegiatanekonomi yang samaatausejenis
  • Tidakadakorespondensilangsung (one-to-one point) antaraaktivitasdenganproduk (ISIC & CPC).
manfaat dan inti analisis
ManfaatdanIntiAnalisis
  • “Institusi”sebagaidasardalampenyusunan diagram rangkaianneracasecaralengkap
  • “Establismen”sebagaidasaruntukanalisisproduksi, Supply and Usedan Input-Output
slide38
Activities

(KegiatanEkonomi)

slide39
Produksi

Konsumsi

Akumulasi

Perilaku Ekonomi

Activities

(kegiatan ekonomi)

activities
Activities
  • Tipikaldariberbagaimacamaktivitasekonomi
  • Aktivitas yang disetarakandalamsatusatuanmoneter
  • Dasarbagipenyusunanneraca
aktivitas ekonomi
AktivitasEkonomi
  • Proses produksi
  • Distribusi dan redistribusi pendapatan
  • Konsumsi
  • Akumulasi/Investasi
aktivitas ekonomi lanjutan
AktivitasEkonomi (lanjutan…..)
  • Produksi: Perusahaan menggunakantenagakerjauntukmemproduksibarangdanjasadanmenjualnyakerumahtanggadanpenggunalainnya
  • Distribusi: Pendapatandaripenjualanbarangdanjasatersebutdigunakanuntukmembayarupahpekerjadankeuntunganbagipemilikperusahaan.
  • Konsumsi: Barang-barang (nondurabledandurable) danjasa-jasa yang dibeliolehrumahtangga; Pemerintahmembelibarangdanjasa-jasanondurable
  • Akumulasi: Barang-barang yang dibeliuntukdigunakandimasa yang akandatang – investasitetapuntukusaha, investasitetaptempattinggal (rumahtangga), daninventori
aktivitas produksi
AktivitasProduksi
  • Untukmenghasilkanbarangdanjasasecaraspesifikdgnmengkombinasiberbagaisumberdayatersediasepertiperalatan, teknikindustri, tenagakerja, produk (bahanbaku)
  • Merupakansatuaktivitastunggal yang dalamprosesmenghasilkanberbagaiproduksecarahomogeensepertibuah, bahanmakanan, hasiltenun, mobil
aktivitas produksi lanjutan
AktivitasProduksi (lanjutan)
  • Aktivitasproduksimerupakanproses yang dilakukan di bawah kendali dan tanggung jawab unit institusi yang menggunakan input tenaga kerja, modal, barang dan jasa untuk menghasilkan output barang dan jasajenis lain
  • Klasifikasi aktivitasproduksi yang digunakan SNA adalah ISIC (Rev.4), yang terdiri dari 21 bagian, 88 divisi, 238 grup, dan 419 kelas
  • TipedariAktivitasproduksi
    • Aktivitasutama (pincipal activities)
    • Aktivitastambahan (secondary activities)
    • Aktivitaspenunjang (ancillary activities)
aktivitas utama
Aktivitasutamadari unit produsenmerupakanaktivtasgunamenghasilkannilaitambahmelebihinilaitambahaktivitas lain yang dilakukandalam unit yang sama.
  • Aktivitasutamasuatu enterprise terdiridariprodukutamadanprodukikutanyaituproduk yang diproduksibersamadenganprodukutama.
  • Output aktivitasutamamencakupbarangataujasa yang mampudisediakanuntuk unit lain, meskipundapatdigunakanuntukkonsumsisendiriataupembentukanmodlsendiri.
AktivitasUtama
aktivitas sekunder
Aktivitassekundermerupakanaktivitas yang dilakukanoleh unit produsendisampingaktivitasutamanya, output aktivitassekunderjugadisediakanuntuk unit lain diluar unit produsen yang bersangkutan.
  • Nilaitambah yang dihasilkanolehaktivitassekunderharuslebihsedikitdariaktivitasutama.
  • Output dariaktivitassekundermerupakanproduksekunder. Banyakprodusenmenghasilkansetidaknyabeberapaproduksekunder.
AktivitasSekunder
aktivitas tambahan
Merupakanaktivitas yang bersifatinsidentialdarisuatu enterprise.
  • Aktivitasinidifasilitasisecaraefisienoleh enterprise tetapitidakmenghasilkanbarangdanjasauntukdipasarkan.
AktivitasTambahan
hubungan antara pelaku dan perilaku ekonomi
Produksi

Konsumsi

(akhir)

Akumulasi (Kapital)

Korporasi

X

Rumah tangga*)

Lembaga nirlaba

X

X

Pemerintah

Luar negeri

HubunganAntaraPelakudanPerilakuEkonomi

actions tindakan ekonomi
Actions(TindakanEkonomi)
  • Bagaimanamengukurnilaitindakan ?

- Posisi/stok (stocks)

- ArusEkonomi (flows)

  • Tipetindakan ?

- Aset (harta)

- Kewajiban (tanggungan)

  • Bagaimanacaramerekamnya ?
slide51
Flows

(Arus Ekonomi)

Stocks

(Posisi)

  • Produksi
  • PMTB
  • Konsumsi
  • Penduduk
  • PMTB
  • Aset
  • Penduduk
  • Hutang
  • Tabungan

Actions

(tindakan)

arus flows dan posisi stocks
Arus (Flows) danPosisi (Stocks)
  • ArusEkonomi (Flows) : Untukmengkuantifikasitindakanekonomiataumengukurperubahannilaiekonomiselamaperiodewaktutertentu
  • Posisi (Stocks) : Untukmengukurperistiwaakibatkegiatan/ tindakanekonomipadawaktusebelumatausesudahkejadianekonomi.

Hubungannya…

Stokterbentukkarenaprosesakumulasiarusdariwaktu-waktusebelumnyaditambahdenganarusselamaperiodepencatatantersebut

arus flows dan posisi stocks1
Arus (Flows) danPosisi (Stocks)
  • Posisi(Stocks)sumberdayadiukurpadasuatutitikwaktutertentu
  • ArusEkonomi(Flows) dicatatdalambentukTansaksi (perubahankepemilikan) barang & jasa, aset & kewajiban, selamaperiodewaktutertentu
arus ekonomi flows
Mencerminkanpenciptaan, transformasi, pertukaran, transfer atauhilangnyanilaiekonomi
  • danmelibatkanperubahanpadakomposisi volume ataunilaiaset/kewajibaninstitusitertentu
  • Dilakukanolehinstitusidalamperekonomiandandiukurolehsektorinstitusiatauperekonomiansecarakeseluruhan
ArusEkonomi(Flows)
contoh flows dan stocks
Contoh : Flows danStocks
  • Kemakmuran (Wealth), Pendapatan (income) danpengeluaran (expenditure)
  • Kapital (modal) danInvestasi
  • HutangPemerintah
  • Kerugiananggaran
  • Aset/Harta
  • Tabungan
  • Inventori/Persediaan
slide56
Stokaset & kewajiban

(1 January 2005)

Arus

Arusekonomibarang & jasa, pendapatan, aset, kewajiban, dst.,

(1 Jan 2005- 31 Dec 2005)

Flows

Stokasetdankewajiban

(31 December 2005)

jenis arus ekonomi
JenisArusEkonomi
  • Dengan perjanjian para pihak terkait
    • Antar unit institusi
    • Didalam unit institusi yang beroperasi dengan kapasitas berbeda
  • Arus lain – perubahan nilai aset dan kewajiban tanpa transaksi
    • Perubahan volume
    • Tingkat dan struktur harga
jenis transaksi arus ekonomi
JenisTransaksi (ArusEkonomi
  • Barang dan Jasa: menunjukkan asal dan penggunaan
  • Distributif (Pendapatan): arus pendapatan yang dihasilkan oleh produksi atas faktor; dan redistribusi pendapatan
  • Instrumen Finansial: akuisi neto dari aset finansial atau pemenuhan kewajiban
  • Akumulasi lain: perubahan kuantitas atau nilai aset & kewajiban (penemuan/pengurangan aset sub-soil, pembelian tanah, keuntungan, kerugian karena perubahan harga
transaksi moneter
TransaksiMoneter
  • Transaksi dengan mitra (“lawan”)

sesuatu untuk sesuatu

  • Transaksi tanpa mitra (“lawan”)

sesuatu untuk nihil

Jasa tenaga kerja

kompensasi

Pemberian

transaksi non moneter
Transaksi Non-Moneter
  • Barter
  • Penyusutan modal tetap
  • Pemberianupahdalambentukbarang
  • Transfer dalambentukbarang
slide62
Transaksi

Berjalan

Akumulasi

Balance

sheet

Produksi

Kapital

Awal Tahun

Pendapatan & pengeluaran

Finansial

Akhir

Tahun

flows

stocks

Accounts

(neraca)

slide63
SistemPencatatan

Format SajianNeraca

  • Neraca “T” : terbagidalam 2 lajur, kiridankanan.

Lajurkananmerekamberbagaitransaksisumber (source) sedanglajurkiritransaksipenggunaan (uses).

  • Tabel : rekapitulasineraca “T”
  • Matriks :

Penyajianneracadalambentukposisisejumlahbaris (m) dansejumlahkolom (n), gunanyauntukmenunjukanhubungantransaksisecaralangsung

slide67
Neraca

Tiga jenis neraca pokok :

  • Neraca transaksi berjalan (Current accounts)
  • Neraca Akumulasi (Accumulation accounts)
  • Neraca Akhir tahun (Balance sheets)
slide68
NeracaTransaksiBerjalan

(Current Accounts)

  • Neraca Produksi
  • Neraca Pendapatan & penggunaan
    • Distribusi primer pendapatan
    • Distribusi sekunder pendapatan
    • Redistribusi pendapatan (inkind)
  • Neraca penggunaan pendapatan
slide70
NeracaProduksi

Item utama

  • Output (keluaran)
  • Konsumsi (biaya) antara
  • Konsumsi barang modal tetap

(penyusutan/depresiasi)

  • Nilai tambah (Value added)

Bruto/Neto

slide71
NilaiTambah (BrutodanNeto)

Nilai Tambah Bruto

  • Output

(minus) biaya/konsumsi antara

Nilai tambah Neto

  • Output

(minus) biaya/konsumsi antara

(minus) konsumsi barang modal tetap

slide73
ProduksidanDistribusi Primer

Output :

(-)input bahanbaku = PDB

(-)input barang modal tetap = PDN

(-)input tenagakerja = Surplus usaha &

Pendapatancampuran

(+)Pendapatanpemilikan, neto = PendapatanNasional

slide74
RedistribusidanDistribusiSekunder

Transfer sosial

  • Bentuk tunai
  • Bentuk barang

Butir (item) penyeimbang: Pendapatan/penerimaan disposabel Nasional/Regional

slide75
NeracaPenggunaanPendapatan

Pendapatan disposabel

(-)Pengeluaran konsumsi aktual

= Tabungan (bruto/neto)

slide77
NeracaAkumulasi

(Accumulation Accounts)

  • Neraca kapital
  • Neraca finansial
  • Perubahan lain dalam aset
  • Neraca revaluasi
slide78
NeracaAkhirTahun

(Balance Sheets)

  • Opening balance sheet
  • Closing balance sheet
slide79
Articulated

(Keterkaitan)

slide80
Double entry

(pencatatan ganda)

Quadraple entry

(pencatatan 4 x)

Articulated

(keterkaitan)

slide81
PencatatanDua Kali

(Double Entry)

  • Prinsip pencatatan ganda, sebagaimana dalam akuntansi perusahaan
  • Setiap transaksi dicatat dua kali
    • Sekali sebagai Sumber (atau perubahan pada kewajiban)
    • Sekali sebagai Penggunaan (atau perubahan pada aset)
  • Oleh karenanya Transaksi total pada kedua sisi harus sama
slide82
PencatatanEmpat Kali

(Quadraple Entry)

  • Dalam neraca nasional yang terdiri dari semua sektor institusi, prinsip pencatatan empat kali dipakai karena sebagian besar transaksi melibatkan dua sektor institusi, sehingga pencatatan dua kali (untuk satu sektor) menjadi empat kali.
slide83
KeterkaitanAntarNeraca

N P

1

N P

2

N P

3

N P

4

Konsolidasi

N P

N P P

1

N P P

2

N P P

3

N P P

4

Konsolidasi

N P P

N K

1

N K

2

N K

3

N K

4

Konsolidasi

N K

N F

1

N F

2

N F

3

N F

4

Konsolidasi

N F

Int. Ner.

1

Int.Ner.

2

Int.Ner.

3

Int.Ner.

4

Neraca

Agregasi

slide85
Prinsip/TatacaraPencatatan
  • Penilaian, (yang mana ?)

- Arus (Flows) dan

- Stok (Stocks)

  • Waktu pencatatan (bilamana ?)

- Akrual (accrual) dan

- Tunai (cash)

  • Pengelompokkan (mengapa ?)

- Neto

- Konsolidasi

- Agregasi

slide86
Basis Akrual
  • Sistem ini merekomendasikan untuk selalu menggunakan basis akrual dalam setiap pencatatan transaksi
  • Akuntansi akrual mencatat arus pada saat nilai ekonominya terbentuk akibat dari proses transformasi, pertukaran, transfer atau punah
  • Sistem akuntansi akrual hanya dapat diaplikasikan untuk mencatat arus “non-moneter” saja
slide87
Basis Akrual Vs Basis Tunai
  • Basis Akrual
    • Penerimaan dicatat apabila barang sudah dijual atau jasa digunakan
    • Pengeluaran dicatat apabila biaya untuk menghasilkan penerimaan sudah dikeluarkan
  • Basis Tunai
    • Penerimaan dicatat apabila sudah diterima secara tunai
    • Pengeluaran dicatat apabila sudah terjadi pengeluaran secara tunai
slide88
WaktuPencatatan
  • Periode akuntansi diantara 2 (dua) waktu pencatatan balance sheet
  • Banyak kegiatan mengawali aktivitasnya pada suatu periode akuntansi dan berakhir pd periode akuntansi berikutnya
  • Dua tipe pendekatan pengukuran yang digunakan untuk mengukur perfoma tersebut adalah

“basis akrual vs basis tunai”

slide89
Pengelompokkan

(Grouping)

  • Neto
  • Konsolidasi
  • Agregasi
slide91
AturanAkuntansiDuaSisiNeraca
  • SisikanandariNeracaberjalanadalahSumber (transaksi yang menambahjumlahnilaiekonomidarisektor, misalnya output dalamneracaproduksi)
  • SisikiridariNeracaberjalanadalahPenggunaan (transaksi yang menguranginilaiekonomidarisektor, misalnyakonsumsiantarapadaneracaproduksi)
slide92
AturanAkuntansiDuaSisiNeraca
  • SisikanandariNeracaAkhirTahun (NAT) adalahKewajibandanKekayaanbersih (selisihantaraasetdankewajiban)
  • SisikiridariNeracaAkhirTahunadalahAset
  • DenganmembandingkanduaNeracaAkhirTahunpadatahun yang berurutankitadapatmengetahuiperubahandalamKewajiban and KekayaanBersihdanperubahanAset
slide93
AturanAkuntansiDuaSisiNeraca
  • Neracaakumulasidan NAT merupakanneraca yang terintegrasisecarapenuh, SisikanandariNeracaakumulasiadalahPerubahanpadakewajibandanKekayaanbersih
  • SisikiridariNeracaAkumulasidisebutPerubahanpadaAset
  • Dalamkasustransaksipadainstrumenfinansial, iniberkaitandenganpemenuhankewajiban (neto) danakuisisiasetfinansial (neto)
slide94
AturanAkuntansi - Rerouting
  • Rerouting transactions
    • Iuranpemberikerja/majikanuntukjaminansosial (Pemberikerjamembayarsahamuntukiuranjaminansosialkepadadanajaminansosial)
    • Pemberikerja (untukpekerja) jaminansosial
  • Partitioning transactions

(peminjammembayaramortisasibulananhutangnya)

amortisasi > cicilanhutang (pokok) + bunga

slide95
AturanAkuntansi - Penilaian
  • Transaksidinilaiatasdasarhargasebenarnya yang disetujuiolehpelakutransaksi
  • Nilaiatasdasarhargapasar
    • Nilaididasarkanpadahargadipasar
  • Untuktransaksinon-pasarpenilaiandibuatmenurutBiaya yang terjadi
slide96
AturanAkuntansi – PencatatanTransaksi
  • Nilaiprodukapakahmenurut
    • Hargadasar
    • Hargaprodusen
    • Hargapembelian
  • Impordanekspordicatatpadanilaiperbatasan (border) (fob)
slide97
AturanAkuntansi – PencatatanTransaksi
  • Pencatatantransaksibruto
  • Pencatatantransaksineto

P = Penggunaan S = Sumber

P

S

P

S

Transfer Kapital yang dibayar

Transfer Kapital yang diterima

Transfer Kapital neto yang diterima

Pencatatan Neto

Pencatatan Bruto

pencatatan transaksi
Pencatatan Transaksi
  • Barang dan Jasa * barang dan jasa
  • Barang dan Jasa * pendapatan
  • Barang dan Jasa * instrumen finansial
  • Pendapatan * instrumen finansial
  • Instrumen finansial * instrumen finansial
klasifikasi aset secara umum
KLASIFIKASI ASET SECARA UMUM

Finansial

Aset

Diproduksi

Non-Finansial

Tdk diproduksi

klasifikasi aset aset lanjutan
KLASIFIKASI ASET-ASET (lanjutan)

Aset Finansial

Dengan kewajiban

Tanpa kewajiban

  • Deposito bank
  • Pinjaman
  • Saham & Modal
  • Cadangan asuransi
  • Aset-aset lain
  • Kewajiban lain
  • Emas moneter
  • SDR’s
klasifikasi aset lanjutan
KLASIFIKASI ASET (lanjutan)

Aset Non-Finansial

Diproduksi

Tdk diproduksi

Tetap

Inventori

Berharga

Tak berwjd

Berwujud

Material

Logam

mulia

  • Goodwill
  • Leases
  • Tanah
  • Aset subsoil
  • Hutan yg tdk
  • dibududayakan

Tak berwujud

Berwujud

  • Software
  • Entertainment
  • Mineral Exploration
  • Rumah tinggal
  • Bangunan lainnya
  • M&E
  • Aset yg dibudidayakan (buah2an, ternak)
ad