slide1 l.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Presented by Dr. Jorge Arévalo Zelada Laboratorio de Biología Molecular y Celular de Tripanosomátidos IMTAvH-UPCH PowerPoint Presentation
Download Presentation
Presented by Dr. Jorge Arévalo Zelada Laboratorio de Biología Molecular y Celular de Tripanosomátidos IMTAvH-UPCH

Loading in 2 Seconds...

play fullscreen
1 / 37

Presented by Dr. Jorge Arévalo Zelada Laboratorio de Biología Molecular y Celular de Tripanosomátidos IMTAvH-UPCH - PowerPoint PPT Presentation


  • 392 Views
  • Uploaded on

Presented by Dr. Jorge Arévalo Zelada Laboratorio de Biología Molecular y Celular de Tripanosomátidos IMTAvH-UPCH. GENERAL AIM OF THE LEISHMANIASIS RESEARCH GROUP

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Presented by Dr. Jorge Arévalo Zelada Laboratorio de Biología Molecular y Celular de Tripanosomátidos IMTAvH-UPCH' - jaden


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide1

Presented by

Dr. Jorge Arévalo Zelada

Laboratorio de Biología Molecular y Celular de Tripanosomátidos

IMTAvH-UPCH

slide3

GENERAL AIM OF THE LEISHMANIASIS RESEARCH GROUP

  • To understand parasite and environment contributions to disease transmission and disease evolution using molecular tools to track down phenotype polymorphism and parasite population heterogeneity. These features might be associated to disease manifestations.
  • To develop molecular tools for better diagnostic procedures, specially under conditions where they show clear cost/benefit comparative advantages over conventional laboratory diagnosis.
slide4

SPECIFIC OBJECTIVES WITHIN DGIS FRAMEWORK

  • Formal assessment of diagnostic performance of Leishmania DNA detection procedures within a hospital service attending skin ulcers.
  • Development of new DNA targets and methodologies to improve parasite detection and to be capable of Leishmania identification in skin biopsies without the need of culture.
  • To transfer know how to other research groups at the IMTAvH.
  • To develop human resources with skills and material facilities to carry out gene expression studies.
  • To develop an animal model that allows to study the possible links between Vitamin A, immunological response and disease course infection.
slide5

Diagnostic performance of Leishmania DNA detection procedures within a hospital service

  • · Joint work with the Clinical component through the skin ulcer project.
  • · Laboratory responsible: Leyda Cabrera
  • · Clinical responsible: Tine Verdonck
slide8

Patients attending the IMTAvH

  • Samples provided by the Clinical component
  • DNA extraction and PCR detection procedures
  • Hybridization and non radioactive detection procedures
  • Diagnostic results delivered according health service needs
slide9

New targets and methodologies For detection and identification of leishmania in skin biopsies

  • · Joint work with the Protozoology unit.
  • · Laboratory responsible: Kathleen Victoir & Jean Claude Dujardin
  • Clinical responsible: Alejandro LLanos
slide10

Gp63 gene organization and DNA sequencing at the IMT (Antwerp)

  • Former tests with cultures parasites at the IMT (Antwerp)
  • Assays with biopsies from experimentally infected animals at the IMTAvH (Lima)
  • Assays with biopsies from patients (Lima and Antwerp)
slide11

EEBS EBS B B BE BSE BS

G3411

EBS E B B B B B BS

EBS

EBS

EEBSEEBS EBS

C4121

BB BB BB BS E SB B BEB BS B B B E BSE B

C1211

** **

E S E S E S S E SBS ES ES ESBS BSS ESS BS SBEBSB

C711/D9311

B B B B B B B B B B B B B B S E S E S E S S E S

A811

B B B B B B B B B B B B B B B B B B B B B B

B9211

5 kb

Gp63 gene locus (partial) in L.(V.)braziliensis

slide12

Gp63- RFLP analysis

15.8 kb

10.9 kb

9.8 kb

3.7 kb

3 kb

N

C

S

L.(V.) braziliensis

L.(V.) peruviana

sensitivity of gp63 pcr detection
Sensitivity of gp63 PCR detection
  • 22 samples analysed by kDNA PCR (all +), gp63 PCR and parasitology
  • gp63 PCR: 91%
  • parasitology: 27%
sensitivity and clinical form
Sensitivity and clinical form
  • 7 cutaneous samples (kDNA+):

gp63 PCR: 100%

parasitology: 57%

  • 15 mucosal samples (kDNA+):

gp63 PCR: 86%

parasitology: 13%

slide16

PCR-RFLP (x = biopsy)

x x b p g b p l x x x g x b p

SalI ApaLI ApaI

conclusions
Conclusions
  • Gp63 PCR-RFLP: complementary tool
  • plus: discrimination of species and intra-specific populations (NW and OW)
  • applications: prognosis, epidemiological surveillance, imported pathologies...
prospects
Prospects
  • Increasing sensitivity of detection (nested et al.)
  • Simplification of the assay
  • Alternative genomic targets
  • Link with biological features
thanks
Thanks
  • K.Victoir, S.De Doncker, M.Boelaert & D.Le Ray: ITG Antwerpen
  • L.Cabrera, E.Alvarez, A.Llanos-Cuentas & J.Arevalo: IMTAvH Lima
  • S.Rijal: BPKIHS, Dharan, Nepal
  • S.Guerbouj, IPT Tunis
  • N.Nuwayri-Salti, AUB Beyruth

EC, DGIS, FWO

slide20

OTHER TARGETS

  • The following are not sequences developed with DGIS direct support but they will be used to design DNA primers that will be used under the same concept of gp63 genes.
  • · rDNA InteGenic Sequences (IGS)
  • · Cistein proteinase b (cpb) like genes
slide21

IGS Restriction Map of Leishmania peruviana, HB44 strain

Promotora ETS

Figure 1.. IGS from HB44 was amplified and cloned into TOPO XL. A recombinant clone , N44 containing a 6500pb insert. The Figure also shows the place of primers annealing sites (arrows) It also depicts the beta and delta sequences (blue bars underlined)

slide22

IGS Restriction Map of Leishmania peruviana, LCA04 strain

2000

Figure 2.. IGS from LCA 04 was amplified and cloned into TOPO XL. A recombinant clone , S04 containing a 5500pb insert. The Figure also shows the place of primers annealing sites (arrows) It also depicts the beta and delta sequences (blue bars underlined)

slide24

Cla I

XhoI

Cla I

XhoI

Cla I

XhoI

EcoRI

XhoI

XhoI

EcoRI

XhoI

1800 bp

2300 bp

3000 bp

PROPOSED MODEL WITH A THREE CP GENES TANDEM ARRAY

The 5´end gene (1800 bp) was cloned in AZ41 and the central gene in AZ13

slide25

az41CDEGYSGGLQGFGSSETCAFFRCWGTRWAISLSEQELVS 171

az13 TDQGMCGSCWAFSAIGNIESQWYLATHSLISLSEQELVS 180

*:* .*. .*.: . .*: **********

slide26

IntramuRal know how transfer

  • · Joint work with the Mycology unit of the IMTAvH.
  • · Laboratory responsible: whole unit.
  • Edgar Neyra, who was member of the Leishmaniasis research unit, onset the setting up of the molecular biology lab at the Mycology unit. In addition, Livia Santibañez has been also recruited recently.
slide27

Gene expression studies.

  • · Joint work with the Protozoology unit.
  • · Laboratory responsible: Dionicia Gamboa & Jean-Claude Dujardin
slide28

Training of Dionicia Gamboa in basic molecular biology techniques (Antwerp)

Training of Dionisia Gamboa in Differential Display (Maastrich)

Set up Differential Display at Antwerp

Initial training on DNA cloning techniques (Lima)

Identification of target sequence candidates, cloning and sequencing (Antwerp)

Set up Differential Display in Lima

Identification of other target sequence candidates and working with other Leishmania isolates (Lima)

PhD Thesis

slide29

Amastigotes

M L

ML

M= Metacyclics

L=Logaritmic

slide31

Animal model for Vitamin A defficiencies, immunological response and disease course infection

slide37

THE NEXT STEP

  • We aim to become a Molecular Epidemiology Unit that will extend our expertise gained with Leishmaniasis to other infectious diseases relevant to the public health of Peru and other countries of Latinamerica. Two approaches will be undertaken:
  • · Starting new research lines with other pathogens (for example drug resistance)
  • · Supporting molecular research of other groups at the IMTAvH