580 likes | 600 Views
A comprehensive study of algorithms and methods in bioinformatics, balancing computational techniques with biological applications. Prerequisites include knowledge in algorithms, programming skills, and basic statistics understanding. Topics covered include genome sequencing, gene finding, protein folding, sequence alignment, evolution, and microarray analysis. The course aims to equip students with the tools to analyze biological data effectively and discover new insights. Various textbooks are recommended to support learning efforts. National Institutes of Health (NIH) and National Center for Biotechnology Information (NCBI) definitions of bioinformatics are discussed, highlighting its importance in modern biology and the vast job opportunities it offers. The field merges biology, computer science, and information technology to address formal and practical challenges in biological data analysis. Students will gain valuable skills and knowledge for both academic and industry settings. Job opportunities in bioinformatics are on the rise, making it a valuable field to explore. Genomic sequencing, gene finding, protein folding, sequence alignment, evolution, and microarray analysis are key areas in bioinformatics that offer a deeper understanding of biological data analysis and interpretation.
E N D
CS5263 Bioinformatics Lecture 1: Introduction
Outline • Administravia • What is bioinformatics • Why bioinformatics • Topics in bioinformatics • What you will & will not learn • Introduction to molecular biology
Student info • Your name • Email • Enrollment status • Academic background • Interests
Course Info • Instructor: Jianhua Ruan Office: S.B. 4.01.48 Phone: 458-6819 Email: jruan@cs.utsa.edu Office hours: Tues 6:30-7:30, Wed 3-4pm • Web: http://www.cs.utsa.edu/~jruan/teaching/cs5263_fall_2007/
Course description • A survey of algorithms and methods in bioinformatics, approached from a computational viewpoint. • Discussions balanced between algorithmic analyses and biological applications • Prerequisite: • Knowledge in algorithms and data structure • Programming experience • Basic understanding of statistics and probability • Appetite to learn some biology
Textbooks • Required: • An Introduction to Bioinformatics Algorithms by Jones and Pevzner • Recommended: • Biological Sequence Analysis: Probabilistic Models of Proteins and Nucleic Acids by Durbin, Eddy, Krogh and Mitchison • Additional resources • See course website
Grading • Attendance: 10% • At most 2 classes missed without affecting grade • Homeworks: 50% • No late submission accepted • Read the collaboration policy! • Final project and presentation: 40%
What is bioinformatics • National Institutes of Health (NIH): • Research, development, or application of computational tools and approaches for expanding the use of biological, medical, behavioral or health data, including those to acquire, store, organize, archive, analyze, or visualize such data.
What is bioinformatics • National Center for Biotechnology Information (NCBI): • the field of science in which biology, computer science, and information technologymerge to form a single discipline. The ultimate goal of the field is to enable the discovery of new biological insights as well as to create a global perspective from which unifying principles in biology can be discerned.
What is bioinformatics • Wikipedia • Bioinformatics refers to the creation and advancement of algorithms, computational and statistical techniques, and theory to solve formal and practical problems posed by or inspired from the management and analysis of biological data.
Why bioinformatics • Modern biology generates huge amount of data • Human genome sequence has 3 billion bases • Complex relationships among different types of data • Challenges to integrate and analyze data • Algorithmic challenges • Biologists trained to programming are probably not sufficient • Tremendous needs in both academic and industry • Job opportunities • You get the chance to learn something different
AGTAGCACAGACTACGACGAGACGATCGTGCGAGCGACGGCGTAGTGTGCTGTACTGTCGTGTGTGTGTACTCTCCTAGTAGCACAGACTACGACGAGACGATCGTGCGAGCGACGGCGTAGTGTGCTGTACTGTCGTGTGTGTGTACTCTCCT ~500 nucleotides 1. Genome sequencing 3x109 nucleotides
AGTAGCACAGACTACGACGAGACGATCGTGCGAGCGACGGCGTAGTGTGCTGTACTGTCGTGTGTGTGTACTCTCCTAGTAGCACAGACTACGACGAGACGATCGTGCGAGCGACGGCGTAGTGTGCTGTACTGTCGTGTGTGTGTACTCTCCT 1. Genome sequencing 3x109 nucleotides A big puzzle ~60 million pieces Computational Fragment Assembly Introduced ~1980 1995: assemble up to 1,000,000 long DNA pieces 2000: assemble whole human genome
2. Gene Finding Where are the genes? In humans: ~22,000 genes ~1.5% of human DNA
Exon 3 Exon 1 Exon 2 Intron 1 Intron 2 5’ 3’ Splice sites Stop codon TAG/TGA/TAA Start codon ATG 2. Gene Finding Hidden Markov Models (Well studied for many years in speech recognition)
3. Protein Folding • The amino-acid sequence of a protein determines the 3D fold • The 3D fold of a protein determines its function • Can we predict 3D fold of a protein given its amino-acid sequence? • Holy grail of compbio—40 years old problem • Molecular dynamics, computational geometry, machine learning, robotics
query DB 4. Sequence Comparison—Alignment AGGCTATCACCTGACCTCCAGGCCGATGCCC TAGCTATCACGACCGCGGTCGATTTGCCCGAC -AGGCTATCACCTGACCTCCAGGCCGA--TGCCC--- | | | | | | | | | | | | | x | | | | | | | | | | | TAG-CTATCAC--GACCGC--GGTCGATTTGCCCGAC Sequence Alignment Introduced ~1970 BLAST: 1990, most cited paper in history Still very active area of research BLAST Efficient string matching algorithms Fast database index techniques
Sequence conservation implies function • Sequence comparison is key to • Finding genes • Determining function • Uncovering the evolutionary processes
5. Evolution More than 200 complete genomes have been sequenced
6. Microarray analysisClinical prediction of Leukemia type • 2 types • Acute lymphoid (ALL) • Acute myeloid (AML) • Different treatment & outcomes • Predict type before treatment? Bone marrow samples: ALL vs AML Measure amount of each gene
Some goals of biology for the next 50 years • List all molecular parts that build an organism • Genes, proteins, other functional parts • Understand the function of each part • Understand how parts interact • Study how function has evolved across all species • Find genetic defects that cause diseases • Design drugs rationally • Sequence the genome of every human, use it for personalized medicine • Bioinformatics is an essential component for all the goals above
Major conferences • ISMB (Summer every year) • RECOMB (and its satellites) (Spring every year) • PSB (Jan every year, Hawaii) • ECCB (Europe) • CSB (July every year, Stanford) • Conferences in computer science • ICDM (conference on data mining) • ICML (conference on machine learning) • AAAI (conference on AI)
Major journals • Bioinformatics • Journal of Computational Biology • PLoS Computational Biology • BMC Bioinformatics • Genome Biology • Genome Research • Nucleic Acids Research • IEEE Trans on Computational Biology • Science, Nature, PNAS, Cell, Nature Genetics, Nature Biotech, …
Covered topics • Sequence analysis • Alignment • Motif finding • Pattern matching • Phylogenetic tree • Sequence-based predictions • Gene components • RNA structure • Functional Genomics • Microarray analysis • Biological networks
What you will learn? • Basic concepts in molecular biology and genetics • Selected topics in bioinformatics and challenges • Algorithms: • DP, graph, string algorithms • Statistical learning algorithms: HMM, EM, Gibbs sampling • Data mining: clustering / classification
What you will not learn? • Existing tools / databases • Design / perform biological experiments • Protein structure prediction (commonly avoided by most bioinfo researchers…) • Building bioinformatics software tools (GUI, database, Perl / Python, …)
Goals • Basis of sequence analysis and other computational biology algorithms • Overall picture about the field • Read / criticize research articles • Think about the sub-field that best suits your background to explore • Communicate and exchange ideas with (computational) biologists
Computer Scientists vs Biologists(courtesy Serafim Batzoglou, Stanford)
Biologists vs computer scientists • (almost) Everything is true or false in computer science • (almost) Nothing is ever true or false in Biology
Biologists vs computer scientists • Biologists seek to understand the complicated, messy natural world • Computer scientists strive to build their own clean and organized virtual world
Biologists vs computer scientists • Computer scientists are obsessed with being the first to invent or prove something • Biologists are obsessed with being the first to discover something
Biologists vs computer scientists • Biologists are comfortable with the idea that all data have errors, and every rule has exceptions • Computer scientists are not
Biologists vs computer scientists • Computer scientists get high-paid jobs after graduation • Biologists typically have to complete one or more 5-year post-docs...
Molecular biology 101 • Cell • DNA, RNA, Protein • Genome, chromosome, gene • Central dogma
Life • Categories • Prokaryotes (e.g. bacteria) • Unicellular • No nucleus • Eukaryotes (e.g. fungi, plant, animal) • Unicellular or multicellular • Has nucleus • The most important distinction among groups of organism
Prokaryote vs Eukaryote • Eukaryote has many membrane-bounded compartment inside the cell • Different biological processes occur at different cellular location
Chemical contents of cell • Small molecules • Sugar • Ions (Na+, Ka+, Ca2+, Cl- ,…) • … • Macromolecules (polymers): • DNA • RNA • Protein • … • Polymers: “strings” made by linking monomers from a specified set (alphabet)
DNA • DNA: forms the genetic material of all living organisms • Can be replicated and passed to descendents • Contains information to produce proteins • To computer scientists, DNA is a string made from alphabet {A, C, G, T} • e.g. ACAGAACGTAGTGCCGTGAGCG • Each letter is called a base • A deoxyribonucleotides • Length varies. From hundreds to billions
RNA • Historically thought to be information carrier only • DNA => RNA => Protein • New roles have been found for them • To computer scientists, RNA is a string made from alphabet {A, C, G, U} • e.g. ACAGAACGUAGUGCCGUGAGCG • Each letter is called a base • A ribonucleotides • Length varies. From tens to thousands
Protein • Protein: the actual “worker” for almost all processes in the cell • Enzymes: speed up reactions • Signaling: information transduction • Structural support • Production of other macromolecules • Transport • To computer scientists, protein is a string built from 20 letters • E.g. MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGP • Each letter is called an amino acid • Lengths: from tens to thousands
DNA/RNA zoom-in • Commonly referred to as Nucleic Acid • DNA: Deoxyribonucleic acid • RNA: Ribonucleic acid • Found mainly in the nucleus of a cell (hence “nucleic”) • Contain phosphoric acid as a component (hence “acid”) • They are made up of nucleotides
Nucleotides • A nucleotide has 3 components • Sugar (ribose in RNA, deoxyribose in DNA) • Phosphoric acid • Nitrogen base • Adenine (A) • Guanine (G) • Cytosine (C) • Thymine (T) or Uracil (U)
Monomers of RNA • A ribonucleotide has 3 components • Sugar - Ribose • Phosphate group • Nitrogen base • Adenine (A) • Guanine (G) • Cytosine (C) • Uracil (U)
Monomers of DNA • A deoxyribonucleotide has 3 components • Sugar - Deoxyribose • Phosphoric acid • Nitrogen base • Adenine (A) • Guanine (G) • Cytosine (C) • Thymine (T)