teknologi informasi n.
Skip this Video
Loading SlideShow in 5 Seconds..
TEKNOLOGI INFORMASI PowerPoint Presentation
Download Presentation

Loading in 2 Seconds...

play fullscreen
1 / 100

TEKNOLOGI INFORMASI - PowerPoint PPT Presentation

  • Uploaded on


I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'TEKNOLOGI INFORMASI' - howe

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
teknologi informasi


Disusunoleh :


SMAN 1 SELESAIT.A 2012/2013

kata pengantar
  • Dunia IT saatinisanterdibicarakandimana-mana. Mengingatkemajuanteknologiperkembanganjauhlebihcepat. Terbukti, untukmengetahuibagaimanabudayabangsaAborigincukuphanyadengansekaliklik. Duniabisadilihatlangsungdi home office masing-masingindividu yang mendalamiIlmuPengetahuanTeknologidanInformasi. Demikianderasnyaarusperkembangan IT membuatsiapapunkewalahanbilainginmengadopsinyasekaligusdalamsatuwaktu.
  • PengantarTeknologiInformasiadalahsebuahmatakuliah yang diberikankepadaseluruhmahasiswa STMIK PPKIA, tidakterkecualiMahasiswajurusan Diploma Satu. MelaluiWadahinipenulisberusahamemberikankaryamurnihasilanalisasetelahmembacabeberapabuahreferensi yang penuliskaitkanantarsatusama lain agar menjadisebuahbahanacuandalammendalamimatakuliah yang satuini, PTI.
  • Semogawadahbisamenjadi media yang dapatmemberikontribusidalamtahappencerahandalammemahamidunia IT. Dunia IT tanpa basic pengetahuan yang mendalambagaikansebilahpedangtajambermatadua. Bilatidakhati-hatimengunakannyakelakakanmembahayakandirisendiridanorang lain yang selayaknyamendapatkanmanfaatdariilmu yang diterapkan.
daftar isi

KATA PENAGNTAR …………………………………………………………………………………

DAFTAR ISI ………………………………………………………………………………………….

BAB I PENDAHULUAN …………………………………………………………………………….

BAB II PERMASALAHAN ………………………………………………………………………….

BAB III PEMBAHASAN …………………………………………………………………………….

BAB IV KESIMPULAN DAN SARAN ……………………………………………………………..

DAFTAR PUSTAKA ………………………………………………………………………………...

bab i pendahuluan
  • Perkembangan internet menyebabkanterbentuknyasebuahduniabaru yang lazimdisebutduniamaya. Di duniamayainisetiapindividumemilikihakdankemampuanuntukberinteraksidenganindividu lain tanpabatasanapapun yang dapatmenghalanginya. Sehinggaglobalisasi yang sempurnasebenarnyatelahberjalandiduniamaya yang menghubungkanseluruhkomunitas digital.
  • Dari seluruhaspekkehidupanmanusia yang terkenadampakkehadiran internet, sektorbisnismerupakansektor yang paling terkenadampakdariperkembanganteknologiinformasidantelekomunikasiserta paling cepattumbuh. Melalui e-commerce, untukpertamakalinyaseluruhmanusiadimukabumimemilikikesempatandanpeluang yang sama agar dapatbersaingdanberhasilberbisnisdiduniamaya.
bab ii permasalahan
  • Pengenalanteknologiinformasi
  • TeknologiInformasi (TI)
  • komputer
  • internet
bab iii pembahasan pengenalan teknologi informasi
BAB III PEMBAHASANPengenalanTeknologiInformasi
  • TI adalahbidangpengelolaanteknologidanmencakupberbagaibidang yang termasuktetapitidakterbataspadahal-halsepertiproses, perangkatlunakkomputer, sisteminformasi, perangkatkeraskomputer, bahasa program , dan data konstruksi. Singkatnya, apa yang membuat data, informasiataupengetahuan yang dirasakandalam format visual apapun, melaluisetiapmekanismedistribusi multimedia, dianggapbagiandari TI. TI menyediakanbisnisdenganempat set layananintiuntukmembantumenjalankanstrategibisnis: prosesbisnisotomatisasi, memberikaninformasi, menghubungkandenganpelanggan, danalat-alatproduktivitas.
pengenalan teknologi informasi
  • TI melakukanberbagaifungsi (TI Disiplin/Kompetensi) darimeng-instalAplikasiuntukmerancangjaringankomputerdanDatabaseinformasi. Beberapatugas yang TI lakukanmungkintermasukmanajemen data, jaringan, rekayasaperangkatkeraskomputer, database dandesainperangkatlunak, sertamanajemendanadministrasisistemsecarakeseluruhan. Teknologiinformasimulaimenyebarlebihjauhdarikonvensionalkomputerpribadidanteknologijaringan, danlebihkedalamintegrasiteknologi lain sepertipenggunaanponsel, televisi, mobil, danbanyaklagi, yang meningkatkanpermintaanuntukpekerjaan .
pengenalan teknologi informasi1
  • Di masalalu, para (DewanAkreditasiuntuk Engineering danTeknologi) danAsosiasiuntukmesinkomputasitelahbekerjasamauntukmembentukakreditasidanstandarkurikulum[4]untuk program degrees diTeknologiInformasisebagaibidangstudidibandingkan[5]denganIlmuKomputer and SistemInformasi. SIGITE (Special Interest Group for IT Education)[6]adalahkelompokkerja ACM untukmendefinisikanstandarini. Pendapatanlayanan TI diseluruhduniasebesar $ 763.000.000.000 ditahun 2009.[7]
teknologi informasi1
  • Pengertianinformasi, TeknologiInformasidanhubungannyadenganlayananinformasi.Informasiadalahbendaabstrak yang dapatdipergunakanuntukmencapaitujuanpositifdanatausebaliknya. Informasidapatmempercepatataumemperlambatpengambilankeputusan. Dengandemikianinformasimemilikikekuatan, baik yang membangunmaupun yang merusak.Dalamprakteknya, informasidapatdisajikandalamberbagaibentukbaiklisan (oral), tercetak (printed), audio, maupun audio-visual gerak yang masing-masingmemilikicirikhas, kelebihandankekurangan, sebagaimanatabeldibawahini:
teknologi informasi2
  • SifatInformasiTercetak-Audio-AudioVisualTercetak Audio Audio-Visual- dapatdibaca, dimanadankapansaja- dapatdibacaberulang-ulang- dayarangsangrendah- pengolahanbisamekanis, bisaelektris- biayarelatifrendah.- Dayajangkauterbatas - Dapatdidengarbilasiaran- Dapatdidengarkembalibiladiputarkembali.- Dayarangsangrendah.- Elektris.- Relatifmurah.- Dayajangkaubesar. - Dapatdidengardandilihatbilasiaran.- Dapatdidengardandilihatkembalibiladiputarkembali.- Dayarangsangsangattinggi.- Sangatmahal.- Dayajangkaubesar, kecualibioskop.
teknologi informasi3
  • Menurut Shannon dan Weaver, informasisebagaiobjekmateriilmukomunikasimempunyaimakna: Patterned matter-energy that affects the probabilities of alternatives available to an individual making decision (halatauenergi yang terpolakan yang mempengaruhidanmemungkinkanseseorangmembuatkeputusandaribeberapakemungkinan yang ada) (Shannon dan Weaver, 1949).Informasibermanfaatuntukmencapaitujuan ideal maupun material. Di akhirabad ke-20 informasimampumenempatkandirisebagaikomoditas yang sangatpotensialuntukmendatangkanmateri. Informasidapatdikembangbiakkan, diolah, dandiperdagangkanuntuktujuan material; ataudisajikanuntukmempengaruhisikap mental individusepertiiklan (material) danpublikasi/propaganda ataulayanansosial (ideal). KenyataaninisebagaimanadisinggungolehTanudikusumah (1984) yang menyatakan: "Kelakmanusiaakan "berternak" informasi, dandari "berternak" informasiinimanusiaakanmemperdagangkannyadanmemperolehkeuntungandarinya (Tanudikusumah, 1984).
teknologi informasi4
  • Everett M. Rogers (1986) dalam Communication Technology menyatakanbahwateknologibiasanyamemilikiduaaspek, yaituperangkatkeras (objekmateridansifatnya), danaspekperangkatlunak (dasarinformasiuntukmenggerakkanperangkatkerasitu). Sedangkanbatasanmengenaiteknologiinformasiitu, Rogers menyatakan:"Teknologiinformasiadalahperangkatkerasbersifatorganisatoris, danmeneruskannilai-nilaisosialdengansiapaindividuataukhalayakmengumpulkan, memproses, dansalingmempertukarkaninformasidenganindividuataukhalayak lain (Rogers, 1986).
teknologi informasi5
  • Dari beberapapengertiandiatasdapatdisimpulkansecarasederhanabahwateknologiinformasimerupakanseperangkatfasilitas yang terdiridariperangkatkerasdanperangkatlunak yang dalamprakteknyadiarahkanuntukmendukungdanmeningkatkankualitasinformasi yang sangatdibutuhkanolehsetiaplapisanmasyarakatsecaracepatdanberkualitas. Berkatteknologiinformasiinilah, informasi yang adadisetiaptempatpadadetik yang samadapatdipantauditempat lain meskipuntempatituberadadibelahanbumi yang lain, ataubahkandiruangangkasasekalipun.Dewasainisemakindirasakanpentingnyapemanfaatanteknologiinformasisebagaisaranauntuklayananinformasibagimasyarakatgunamendukungpenyelenggaraan program-program pemerintah. Pemerintahbagaimanapuntidakdapatmengkesampingkankeberadaanteknologiinformasikarenateknilogiinformasimerupakansarana yang paling efektifuntukmenyampaikanataumensosialisasikankebijakan-kebijakanpemerintahdalamberbagaibidang. 
teknologi informasi6
  • Teknologiinformasi yang difungsikanuntuklayananinformasikepadamasyarakatmemungkinkanterjadinyapertukaraninformasidalamwaktuseketikatanpadapatdibatasiolehruangdanwaktu. Hal initentuakansangatmendukungsuatudisiplinilmuatausuatujenispekerjaan yang memerlukankecepatanaksesinformasisepertijurnalistikatauekonomi. Jurnalistikmerupakanjeniskerja yang mengutamakanaktualitas/kecepatan; sedangkanpadabidangekonomi/bisnispercepataninformasiakanmembawapengaruhterhadapperolehan profit atausebaliknya.Sudahterbuktisecaranyatabahwabidangpembangunan, perekonomian, bisnis, danbidanglainnyatidakakanmengalamikemajuantanpadiimbangidenganpencapaiankemajuandibidangteknologiinformasi. John Naisbittdan Patricia Aburdene (1984) telahmemprediksikanakanterbentuknyaekonomi global. Prediksiinisaatinitelahmenjadikenyataan, misalnyasajapadasaatiniseseorang yang tengahberadaditengahhutanbelantaradipedalaman Kalimantan dapatsajamelakukantransaksidenganrekanbisnisnya yang adadi New York melaluikomunikasidenganteleponsatelitnya.
teknologi informasi7
  • Olehkarenaitupemanfaatanteknologiinformasiuntuklayananinformasikepadamasyarakatmerupakansuatukeniscayaan. Sebablayananinformasidimasasekaranginitidakakanmembuahkanhasil yang maksimaljikatidakdidukungolehteknologiinformasi. Inilahkaitaneratantarateknologiinformasidenganlayananinformasibagimasyarakat.
teknologi informasi8
  • Padaawalsejarah, manusiabertukarinformasimelaluibahasa. Makabahasaadalahteknologi, bahasamemungkinkanseseorangmemahamiinformasi yang disampaikanolehorang lain tetapiitutidakbertahansecara lama karenaSetelahucapanituselesai, makainformasi yang beradaditangansipenerimaituakandilupakandantidakbisadisimpan lama. Selainitujangkauansuarajugaterbatas.
teknologi informasi9
  • Setelahituteknologipenyampaianinformasiberkembangmelaluigambar. Dengangambarjangkauaninformasibisalebihjauh. Gambarinibisadibawa-bawadandisampaikankepadaorang lain. Selainituinformasi yang adaakanbertahanlebih lama. Beberapagambarpeninggalanzamanpurbamasihadasampaisekarangsehinggamanusiasekarangdapat (mencoba) memahamiinformasi yang ingindisampaikanpembuatnya.
teknologi informasi10
  • Ditemukannyaalfabetdanangkaarabikmemudahkancarapenyampaianinformasi yang lebihefisiendaricara yang sebelumnya. Suatugambar yang mewakilisuatuperistiwadibuatdengankombinasialfabet, ataudenganpenulisanangka, seperti MCMXLIII digantidengan1943. Teknologidenganalfabetinimemudahkandalampenulisaninformasiitu.
teknologi informasi11
  • Kemudian, teknologipercetakanmemungkinkanpengirimaninformasilebihcepatlagi. Teknologielektroniksepertiradio, televisi, komputermengakibatkaninformasimenjadilebihcepattersebardi area yang lebihluasdanlebih lama tersimpan.
teknologi informasi12
  • TI adalahbidangpengelolaanteknologidanmencakupberbagaibidang yang termasuktetapitidakterbataspadahal-halsepertiproses, perangkatlunakkomputer, sisteminformasi, perangkatkeraskomputer, bahasa program , dan data konstruksi. Singkatnya, apa yang membuat data, informasiataupengetahuan yang dirasakandalam format visual apapun, melaluisetiapmekanismedistribusi multimedia, dianggapbagiandari TI. TI menyediakanbisnisdenganempat set layananintiuntukmembantumenjalankanstrategibisnis: prosesbisnisotomatisasi, memberikaninformasi, menghubungkandenganpelanggan, danalat-alatproduktivitas.
teknologi informasi13
  • TI melakukanberbagaifungsi (TI Disiplin/Kompetensi) darimeng-instalAplikasiuntukmerancangjaringankomputerdanDatabaseinformasi. Beberapatugas yang TI lakukanmungkintermasukmanajemen data, jaringan, rekayasaperangkatkeraskomputer, database dandesainperangkatlunak, sertamanajemendanadministrasisistemsecarakeseluruhan. Teknologiinformasimulaimenyebarlebihjauhdarikonvensionalkomputerpribadidanteknologijaringan, danlebihkedalamintegrasiteknologi lain sepertipenggunaanponsel, televisi, mobil, danbanyaklagi, yang meningkatkanpermintaanuntukpekerjaan .
teknologi informasi14
  • Di masalalu, para (DewanAkreditasiuntuk Engineering danTeknologi) danAsosiasiuntukmesinkomputasitelahbekerjasamauntukmembentukakreditasidanstandarkurikulum[4]untuk program degrees diTeknologiInformasisebagaibidangstudidibandingkan[5]denganIlmuKomputer and SistemInformasi. SIGITE (Special Interest Group for IT Education)[6]adalahkelompokkerja ACM untukmendefinisikanstandarini. Pendapatanlayanan TI diseluruhduniasebesar $ 763.000.000.000 ditahun 2009.










  • Komputeradalahalat yang dipakaiuntukmengolahdatamenurutprosedur yang telahdirumuskan. Katacomputersemuladipergunakanuntukmenggambarkanorang yang perkerjaannyamelakukanperhitunganaritmatika, denganatautanpaalat bantu, tetapiartikatainikemudiandipindahkankepadamesinitusendiri. Asalmulanya, pengolahaninformasihampireksklusifberhubungandenganmasalaharitmatika, tetapikomputer modern dipakaiuntukbanyaktugas yang tidakberhubungandenganmatematika.
  • Dalamartisepertiituterdapatalatsepertislide rule, jeniskalkulatormekanikmulaidariabakusdanseterusnya, sampaisemuakomputerelektronik yang kontemporer. Istilahlebihbaik yang cocokuntukartiluasseperti "komputer" adalah "yang mengolahinformasi" atau "sistempengolahinformasi." Selamabertahun-tahunsudahadabeberapaarti yang berbedadalamkata "komputer", danbeberapakata yang berbedatersebutsekarangdisebutdisebutsebagaikomputer.
  • Katacomputersecaraumumpernahdipergunakanuntukmendefiniskanorang yang melakukanperhitunganaritmatika, denganatautanpamesinpembantu. MenurutBarnhart Concise Dictionary of Etymology, katatersebutdigunakandalambahasaInggrispadatahun 1646 sebagaikatauntuk "orang yang menghitung" kemudianmenjelang 1897 jugadigunakansebagai "alathitungmekanis". SelamaPerangDunia II katatersebutmenunjukkepadaparapekerjawanitaAmerikaSerikatdanInggris yang pekerjaannyamenghitungjalanartileriperangdenganmesinhitung.
  • jenis
  • Sekalipundemikian, definisidiatasmencakupbanyakalatkhusus yang hanyabisamemperhitungkansatuataubeberapafungsi. Ketikamempertimbangkankomputer modern, sifatmereka yang paling penting yang membedakanmerekadarialatmenghitung yang lebihawalialahbahwa, denganpemrograman yang benar, semuakomputerdapatmengemulasisifatapa pun (meskipunbarangkalidibatasiolehkapasitaspenyimpanandankecepatan yang berbeda), dan, memangdipercayabahwamesinsekarangbisamenirualatperkomputeran yang akankitaciptakanpadamasadepan (meskipunniscayalebihlambat). Dalamsuatupengertian, bataskemampuaniniadalahtes yang bergunakarenamengenalikomputer "maksudumum" darialatmaksudistimewa yang lebihawal. Definisidari "maksudumum" bisadiformulasikankedalamsyaratbahwasuatumesinharusdapatmeniruMesinTuringuniversal. Mesin yang mendapatdefinisiinidikenalsebagaiTuring-lengkap, dan yang pertamamerekamunculpadatahun 1940 ditengahkesibukanperkembangandiseluruhdunia. Lihatartikelsejarahperkomputeranuntuklebihbanyak detail periodeini.

























  • KomponenHardware
    • Central Processing Unit(CPU)
    • Media PenyimpananatauMemory
    • Input Device (Peralatan Input)
    • Output Device (Peralatan Output)
    • Communication Device (PeralatanKomunikasi)
  • Central Processing Unit (CPU)
    • Komponen CPU :
      • Control Unit
      • Arithmatic Logic Unit (ALU)
  • Machine Cycle (SiklusMesin)
    • Fetch
    • Decode
    • Execute
    • Store
    • Communication Device (PeralatanKomunikasi)
  • FaktorPenentuKemampuanProsesor:
    • System Clock
    • Bus Width
      • I/O Bus
      • Data Bus
    • Word Size
  • JenisProses :
    • Serial Processing
    • Parallel Processing
      • SIMD (Single Instructin Multiple Data)
      • MIMD (MultipleInstructin Multiple Data)
    • Pipeline Processing
  • TahapanProses :
    • Pengambilaninstruksi
    • Penerjamahaninstruksi
    • Ekseskusiinstruksi
    • Penulisanhasilinstruksi
  • Media Penyimpanan (Storage)
    • Primary Storage
      • RAM (Random Access Memory)
        • DRAM (Dynamic RAM)
        • SRAM (Static RAM)
  • EDORAM (Extended Data Out RAM )

72 pin


168 pin

  • ROM (Read Only Memory)
    • PROM
    • EPROM
    • EEPROM
  • Circuit Board
    • SIMM (Single In-line Memory Module)
    • DIMM (Dual In-line Memory Module)
  • Cache Memory (Flash RAM)
  • Video Memory (VRAM)

Video Memory Stick

    • Flash Memory
  • Secondary Storage
    • Magnetic Storage
      • Magnetic tape
        • Magnetic Disk
          • Hard Disk
          • Floppy Disk (Diskette)
      • Optical Storage
  • Representasi data dalammemori : binary digit
  • Karakteristik Media Penyimpanan
    • Kecepatan
    • Volatility
    • MetodeAkses
      • Serial Access
      • Random Access
      • Paralell Access
    • Portability
    • Capacity
  • Hirarki media penyimpananmemori

berdasarkankarakteristiknya :

  • PerbandinganPrimary Storage dan Secondary Storage:
    • Temporary vs Permanent
    • Hanyadapatmenyimpan data jikakomputernyalavsDapatmenyimpan data jikakomputermati
  • Peralatan Input (Input Device)
    • Keyboard
  • Pointing Device
    • Mouse
    • Trackball
    • Joystick
  • Terminal
    • Dumb terminal
    • ATM
    • Point of SalesTerminal
  • Optical Reading Device (scanner)
    • Barcode Reader
    • Handprint Reader
    • Image Scanner
  • PeralatanOutput (Output Device)
    • Visual Display (Monitor)
    • Printer
      • Impact Printer

: dot matrix printer

      • Non Impact Printer

: inkjet printer

  • Plotters
  • Computer Output Microfilm (COM)
  • Audio Response Unit (ARU)

Voice Output Device dalambentukFlash Memory

  • PeralatanKomunikasi(Communication Device)
    • Modem (Modulation Demodulation)
      • External vs Internal Modem
      • Smart Modem
      • Fax modem
  • SistemOperasi

- Pengertian

- Fungsi

- Contohsistemoperasi

- Penjelasan

  • SistemPerangkatLunak
    • System Control Programs
    • System Support Program
      • System Utility Program
      • System Performance Monitor
      • System Security Monitor
  • JenisAplikasiPerangkatLunak
    • Proprietary Application Software
    • Off the shelf Application Software
  • PermasalahanSoftware
    • PemilihandanPenilaianSoftware
    • Software Licensing
    • Software Upgrades
    • Open Systems
    • Open Source Software
  • BahasaPemrograman
    • BahasaMesin (Machine Language)
    • BahasaRakitan (Assembly Language)
    • BahasaProsedural (Procedural Language)
    • BahasatidakProsedural / terprosedure

(Nonprocedural Language)

  • BahasaPemrograman Natural (Natural Language)
  • BahasaPemrograman Virtual
  • HTML (Hypertext Markup Language)
  • Extensible Markup Language (XML)
  • Componentware
  • Virtual Reality Modeling Object
  • BahasaPemrograman Object Oriented
  • BahasaPemrograman Natural (Natural Language)
  • BahasaPemrograman Virtual
  • HTML (Hypertext Markup Language)
  • Extensible Markup Language (XML)
  • Componentware
  • Virtual Reality Modeling Object
  • BahasaPemrograman Object Oriented
  • Data
  • Dataadalahfakta-faktamentahataudeskripsi-deskripsidasardarihal, event, aktivitas, dantraksaksi yang ditangkap, direkam, disimpan, diklasifikasikan, tetapitidakdiorganisasikanuntuktujuanspesifiktertentu. Contoh data antara lain terdiridarisaldo bank, ataujumlah jam pekerja yang bekerjadalamperiodepembayaran.
  • Informasi
  • Informasiadalahsekumpulanfakta (data)

yang diorganisirdengancaratertentusehinggamerekamempunyaiartibagisipenerima. Sebagaicontoh, bilakitamemasukkannama-namamuriddengannilai rata-rata, nama-namakonsumendengansaldo bank, jumlahgajidengnajumlah jam bekerja, kitaakanmendapatkaninformasi yang berguna. Dengankata lain, informasidatangdari data yang akandiproses.

  • Pengetahuan
  • Pengetahuanterdiridariinformasi yang sudahdiorganisasikandandiprosesuntukmemperolehpemahaman, pengalaman, pembelajaran yang terakumulasi, sehinggadapatdiaplikasikandalammasalahatauprosesbisnistertentu.
  • Pengetahuandapatjugadiartikansebagaiinformasi yang diprosesuntukmengekstrakimplikasikritisdanmerefleksikanpengalamanmasalampaumenyediakanpenerimadenganpengetahuan yang terorganisasidengannilai yang tinggi.
komputer pengorganisasian data dan informasi cont
KOMPUTERPengorganisasian Data danInformasi (cont.)
  • Hirarki Data
    • Bits
    • Fields
    • Record
  • MetodeAksesRecord :
    • Index Sequential Access Method(ISAM)
    • Direct File Access Method
  • File
    • PermasalahanPendekatanFile
      • Data redundancy (Duplikasi)
      • Data inconsistency (Data tidakKonsisten)
      • Data Isolasion (Pemisahan)
      • Data Integrity
      • Aplikasi/data berdirisendiri (independence)
komputer pengorganisasian data dan informasi cont1
KOMPUTERPengorganisasian Data danInformasi (cont.)
  • Pendekatan Modern : Basis Data
    • Data Terpusat (Centralized Database)
    • Data Terdistribusi (Distributed Database)
      • Replicated Database
      • Partitioned Database
  • Pembuatan Basis Data
    • Entity Relationship (ER) Modeling
      • Entity Classes
      • Instance
      • Identifier
      • Relationship
komputer pengorganisasian data dan informasi cont2
KOMPUTERPengorganisasian Data danInformasi (cont.)
  • Database Manajemen System (DBMS)
    • Model Data
    • Data Definition Language (DDL)
    • Data Manipulation Language (DML)
    • Data Dictionary (Kamus Data)
  • Logical Data Model
    • Model Basis Data Hirarki (Hierarchical Database Model)
    • Model Basis Data Jaringan (Network Database Model)
    • Model Basis Data Relasi (Relational Database Model)
komputer pengorganisasian data dan informasi cont3
KOMPUTERPengorganisasian Data danInformasi (cont.)
  • Gudang Data (Data Warehouse)
    • Multidimensinal Data Model
    • Data Mart
    • Data Mining
    • Text Mining
telekomunikasi dan jaringan
Telekomunikasi danJaringan
  • Sistem Telekomunikasi
    • PerangkatKeras
    • Media Komunikasi
    • JaringanKomunikasi
    • PerangkatLunakKomunikasi
    • PenyediaKomunikasi Data
    • ProtokolKomunikasi
    • AplikasiKomunikasi
  • DuaSisiSistem Telekomunikasi
    • PengirimInformasi (Tansmitter of Information)
    • PenerimaInformasi (Receiver of Information)
telekomunikasi dan jaringan cont
Telekomunikasi danJaringan(cont.)
  • FungsiSistem Telekomunikasi
  • Media Telekomunikasi
    • Sinyal Analog
    • Sinyal Digital
  • ProsesorKomunikasi(Communication Processor)
    • Modem
    • Multiplexer
    • Front-end Processor
telekomunikasi dan jaringan cont1
Telekomunikasi danJaringan(cont.)
  • Channel dan Media Komunikasi
    • Media Kabel(Cable Media)
      • Twisted Pair Wire
      • KabelKoaksial
      • Kabel Fiber optic
      • Radio Selular
      • Infra Red
    • Media Penyaringan(Broadcast Media)
      • Microwave Transmission
      • Satellite Transmission
      • Radio
telekomunikasi dan jaringan cont2
Telekomunikasi danJaringan(cont.)
  • Karakter Media Komunikasi
    • KecepatanPengiriman
    • Cara Pengiriman (Transmission Mode)
      • Asynchronous
      • Synchronous
    • KetepatanPengiriman (Transmission Accuracy)
    • PengangkutdanPelayanan Telekomunikasi (Tellecomunication Carriers and Services)
      • Switched and Dedicated Lines
      • Wide-Area Telecomunication (WATS)
      • TelepondanLayananHubunganTelepon (Telephone and Dialing Services)
telekomunikasi dan jaringan cont3
Telekomunikasi danJaringan(cont.)
      • Layanan Yang TerintegrasiJaringan

Digital (Integrated Services Digital Network / ISDN)

      • JalurLangganan Digital (Digital Subscriber Line)
  • Jaringan
    • Jaringan Area Lokal (Local Area Network / LAN)
      • Wireless Local Area Networks (WLANs)
      • TeknologiBluetooth
      • Private Branch Excanges (PBX)
    • Wide Area Networks
      • Value Added Networks
      • Virtual Private Networks (VPNs)
telekomunikasi dan jaringan cont4
Telekomunikasi danJaringan(cont.)
  • SistemOperasiJaringan
    • PerangkatLunakManajemenJaringan
    • Protokol
      • Ethernet
      • TCP/IP
      • Komunikasidiantara Protocol
    • TipeTransmisi Data
      • Packet Switching
      • Frame Relay
      • FDDI
      • ATM
      • dan lain-lain
telekomunikasi dan jaringan cont5
Telekomunikasi danJaringan(cont.)
  • ProsesTerdistribusi
    • Terminal to Host processing
    • File Server Processing
    • Server Architecture and Processing
      • Distributed Presentation
      • Remote Presentation
      • Remote Data Management
      • Distributed Data Management
    • PengolahanPeer-to-peer
telekomunikasi dan jaringan cont6
Telekomunikasi danJaringan(cont.)
  • Aplikasi Telekomunikasi
    • PesanElektronik
    • Videoconferencing
    • Pertukaran Data Elektronik (Electronic Data Interchange / EDI)
    • Transfer Dana Elektronik (Electronic Fund Transfer/ EFT)
    • Facsimiles
    • Telecommuting
    • Distance Learning
  • Internet (kependekandariinterconnection-networking) secaraharfiahialahsistem global dariseluruhjaringankomputer yang salingterhubungmenggunakanstandar Internet Protocol Suite (TCP/IP) untukmelayanimiliaranpenggunadiseluruhdunia. Manakala Internet (huruf 'I' besar) ialahsistemkomputerumum, yang berhubungsecara global danmenggunakanTCP/IPsebagaiprotokolpertukaranpaket (packet switching communication protocol). Rangkaian internet yang terbesardinamakanInternet. Cara menghubungkanrangkaiandengankaedahinidinamakaninternetworking.
  • internet (interconnected computer networks) bisadidefinisikan network komputertiadabatas yang menjadipenghubungpenggunakomputerdenganpenggunakomputerlainnyasertadapatberhubungandengankomputerdisebuahwilayahkewilayahdipenjurudunia, dimanadidalamjaringantersebutmempunyaiberbagaimacaminformasisertafasilitaslayanan internet browsing atau surfing. Istilahinilebihdikenaldengan “online” di internet. Pekerjaaninibisadiibaratkansepertikitaberjalan-jalanditempathiburansembarimelihat-lihatketoko-tokonamuntidakmembelijualantersebut.
  • Lalu, apahubungan internet dengankomputerdanjaringan? Sebenarnya, internet merupakanjaringankomputer pula. Bilajaringankomputerdisekolahmuhanyameliputiseluruhkomputer yang adadisekolah, maka internet merupakanjaringankomputerkomputer yang adadiseluruhdunia. Jaringan internet dibentukolehribuanbahkanjutaanjaringankomputer yang salingterhubungmembentuksatujaringanraksasa yang meliputiseluruhpenjurubumi. Istilah internet berasaldarikata interconnected networking, yaitujaringan yang salingterhubung. Dalamsitus Wikipedia (en.wikipedia.org), internet diartikansebagaisistemjaringan yang salingterhubungsecara global danmenggunakan TCP/IP sebagaiprotokolpertukaranpaket data. Tidakada yang tahupersisberapajumlahkomputer yang terhubungke internet. Yang pasti, jumlahnyajutaanataubahkanmilyaran, dansetiapwaktuterusbertambah.
  • Komputer yang terhubungke internetdapatkamugunakanuntukberkomunikasidansalingtukarmenukar data atauinformasidenganpengguna internet yang lain. Dalamperkembangannya, tidakhanyakomputer yang dapatdisambungke internet. Telepongenggam, satelitkomunikasi, kamera video, pemutarmusikdan video, danberbagaiperalatan lain dapatdisambungkanke internet. Mula-mulasebagaisaranapenghubungantarkomputerdigunakankabeltembaga. Saatini media yang digunakanlebihberagam, sepertimenggunakankabelseratoptik, lewatkabellistrik PLN, dan yang terusdikembangkanadalahkoneksitanpakabelmenggunakangelombangelektromagnetik. Contohnyamenggunakankoneksiwifi yang dipancarkandari hotspot (terminal untukmengakses internet tanpakabel).
  • Secarafisik, internet hanyalahjaringankomputer. Apamaksudnya? Kalaukomputerkomputerhanyaterhubungbegitusaja, tentutidakbanyakmemberimanfaat. Kenyataannya, padaahlitelahmembuatberbagaiaplikasi yang dapatdijalankanmelalui internet. Melaluiaplikasiini, internet dapatdigunakanuntukberbagaikeperluan. Contohnyaadalahmengaksesinformasidarihalaman web, membacaberita-beritaterbaru, mengirimkansuratelektronik (e-mail), chatting, berbagikartuucapan, berbagi file musikdanrekaman video, berbelanja online (dilakukanmelaluikoneksi internet), menikmatisiarantelevisidan radio online, main game online, konferensijarakjauh, danmasihbanyak yang lain. 
  • Jaringan internet tidakdibatasiolehnegara. Artinyapenggunadarinegaramanasajaberhakuntuksalingbertukarinformasidanmemberdayakaninformasi yang adadi internet. Internet tidakada yang memilikisehinggatidakadakontrolataukendalisecaraterpusat. Namundemikianadabadan/lembaga yang mengaturberbagaistandardanpendataanuntukmelaksanakankoneksi internet.
  • Ada internet, ada pula intranet danekstranet. Apaitu intranet danekstranet? Intranet jugamerupakanjaringankomputer. Bedanya, bila internet merupakanjaringankomputerdenganskala global, maka intranet merupakanjaringankomputerdengancakupanwilayah yang terbatas. Menurutsitus Wikipedia (en.wikipedia.org), intranet adalahsebuahjaringankomputerdalamjangkauanterbatas (privat), yang menggunakanprotokol-protokol internet (TCP/IP) untukmembagiinformasi internal suatusistemorganisasikepadaanggotanya. Singkatnya, intranet menggunakansaranakomunikasidanaplikasiseperti internet, namundalamcakupan yang terbatas.
  • Secaraumumadabanyakmanfaat yang dapatdiperolehapabilaseseorangmempunyaiakseske internet .Berikutinisebagiandariapa yang tersediadi internet: 1. Informasiuntukkehidupanpribadi :kesehatan, rekreasi, hobby, pengembanganpribadi, rohani, sosial. 2. Informasiuntukkehidupanprofesional/pekerja :sains, teknologi, perdagangan, saham, komoditas, beritabisnis, asosiasiprofesi, asosiasibisnis, berbagai forum komunikasi.Satuhal yang paling menarikialahkeanggotaan internet tidakmengenalbatasnegara, ras, kelasekonomi, ideologiataufaktorfaktor lain yang biasanyadapatmenghambatpertukaranpikiran. Internet adalahsuatukomunitasdunia yang sifatnyasangatdemokratissertamemilikikodeetik yang dihormatisegenapanggotanya. Manfaat internet terutamadiperolehmelaluikerjasamaantarpribadiataukelompoktanpamengenalbatasjarakdanwaktu.Untuklebihmeningkatkankualitassumberdayamanusiadi Indonesia, sudahwaktunyaparaprofesional Indonesia memanfaatkanjaringan internet danmenjadibagiandarimasyarakatinformasidunia.
  • Fungsi internet

Secaraumum, addabeberapahalpokok yang biasadilakukandi internet, yaitu :

  • Memperolehinformasi
  • Berkirim-kirimansurat
  • Chatting
  • Melakukantransaksidagang
  • Berdiskusi
  • Memasangiklanbaris

Alamat Website

setiap website di internet mempunyaialamattertentubiasanyaalamat website mempunyaihubungandenagnlembagaatauorganisasipemilik website tersebut. Sebuahalamat website merupakankombinasidariprotokoll yang digunakan, nama host, dannama domain. Nama domain sendiridapatterdiridariperusahaanataunama website besertakodekode yang menjelaskanasaldanbentukorganisasidaripemilik website tersebt

  • Web Site atauSitusPengertian Web Site atauSitusSitusdapatdiartikansebagaikumpulanhalaman-halaman yang digunakanuntukmenampilkaninformasi, gambargerak, suara, danataugabungandarisemuanyaitubaik yang bersifatstatismaupundinamis yang membentuksaturangkaianbangunan yang salingterkaitdimanamasing-masingdihubungkandengan link-link.
  • World Wide Web
    • BrowserPenyaringInformasi
    • Offline Browser Web Authoring
    • MesinPencari (Search Engine) Personalized Web Service
    • Push Technology Clipping Services
  • Pemeliharaan Web Site atauSitusUntukmendukungkelanjutandarisitusdiperlukanpemeliharaansetiapwaktusesuai yang diinginkansepertipenambahaninformasi, berita, artikel, link, gambaratau lain sebagainya. Tanpapemeliharaan yang baiksitusakanterkesanmembosankanataumonotonjugaakansegeraditinggalpengunjung.Pemeliharaansitusdapatdilakukan per periodetertentusepertitiaphari, tiapmingguatautiapbulansekalisecararutinatausecaraperiodiksajatergantungkebutuhan(tidakrutin). Pemeliharaanrutinbiasanyadipakaiolehsitus-situsberita, penyediaartikel, organisasiataulembagapemerintah. Sedangkanpemeliharaanperiodikbisanyauntuksitus-situspribadi, penjualan/e-commerce, dan lain sebagainya.
  • Jumlahpengguna Internet yang besardansemakinberkembang, telahmewujudkanbudaya Internet. Internet jugamempunyaipengaruh yang besaratasilmu, danpandangandunia. DenganhanyaberpandukanmesinpencarisepertiGoogle, penggunadiseluruhduniamempunyaiakses Internet yang mudahatasbermacam-macaminformasi. Dibandingdenganbukudanperpustakaan, Internet melambangkanpenyebaran(decentralization) / pengetahuan (knowledge) informasidan data secaraekstrem.
  • Perkembangan Internet jugatelahmemengaruhiperkembanganekonomi. Berbagaitransaksijualbeli yang sebelumnyahanyabisadilakukandengancaratatapmuka (dansebagiansangatkecilmelalui pos atautelepon), kinisangatmudahdanseringdilakukanmelalui Internet. Transaksimelalui Internet inidikenaldengannamae-commerce.
  • Terkaitdenganpemerintahan, Internet jugamemicutumbuhnyatransparansipelaksanaanpemerintahanmelaluie-governmentsepertidikabupatenSragen yang manaternyataberhasilmemberikanpeningkatanpemasukandaerahdenganmemanfaatkan Internet untuktransparansipengelolaandanamasyarakatdanpemangkasanjalurbirokrasi, sehinggawargadidaerahterebutsangatdiuntungkandemikianparapegawainegerisipildapat pula ditingkatkankesejahterannyakarenapemasukandaerahmeningkattajam.
  • Samasepertihalnyasebuahkomunitas, Internet jugamempunyaitatatertibtertentu, yang dikenaldengannamaNettiquetteataudalambahasa Indonesia dikenaldenganistilahnetiket.
  • Untukdi Indonesia selaintatatertibsosialdi Internet jugadiberlakukanperaturan (UU ITE).
  • NetiquettemerupakanEtikadalammenggunakanInternet. Internet sebagaisebuahkumpulankomunitas, diperlukanaturan yang akanmenjadiacuanorang-orangsebagaipengguna Internet, dimanaaturaninimenyangkutbatasandancara yang terbaikdalammemanfaatkanfasilitas Internet.
  • SebenarnyaNettiquette in adalahhal yang umumdanbiasa, samahalnyadenganaturan-aturanbiasaketikakitamemasukikomunitasumumdimanainformasisangatbanyakdanterbuka.
  • Beberapaaturan yang adapadaNettiqueteiniadalah:
  • Amankanduludirianda, maksudnyaadalahamankansemuapropertianda, dapatdimulaidarimengamankankomputeranda, denganmemasang anti virus atau personal firewall
  • Janganterlalumudahpercayadengan Internet, sehinggaandadenganmudahmengunggah data pribadianda. danandaharusbetul-betulyakinbahwaalamat URL yang andatujutelahdijaminkeamanannya.
  • dan yang paling utamaadalah, hargaipengguna lain di internet, caranyasederhanayaitu,:
  • a. janganbiasakanmenggunakaninformasisecarasembarangan, misalnyaplagiat.b. janganberusahauntukmengambilkeuntungansecarailegaldari Internet, misalkanmelakukankejahatanpencurian no kartukreditc. janganberusahamenggangguprivasiorang lain, denganmencobamencuriinformasi yang sebenarnyaterbatas.d. janganmenggunakanhurufkapitalterlalubanyak, karenamenyerupaikegiatanteriak-teriakpadakomunitassesungguhnya.e. janganflamming (memanas-manasi), trolling (keluardaritopikpembicaraan) ataupun junking (memasang post yang tidakberguna) saatberforum.
  • Layanan yang Disediakanoleh Internet :
    • LayananKomunikasi
      • e-mail
      • USENET Newsgroup(Forums)
      • LISTSERV
      • Chatting
      • Instant Messaging
      • Telnet
      • Internet Telephony
      • Internet Fax
      • Streaming Audio dan Video
      • Real-time Audio dan Video
  • Negara denganakses Internet yang terbaiktermasukKorea Selatan (50% daripadapenduduknyamempunyaiaksesjalurlebar - Broadband), danSwedia. Terdapatduabentukakses Internet yang umum, yaitudial-up, danjalurlebar. Di Indonesia, sepertinegaraberkembangdimanaakses Internet danpenetrasi PC sudahcukuptinggidengandidukungnya Internet murahdannetbookmurah, hanyasajadi Indonesia operator kurangadildalammenentukanhargadanbahkanadasalahsatu operator yang sengajamembuat "jebakan" agar pengguna Internet tersebutmembayarlebihmahal. Lainnyasekitar 42% dariakses Internet melaluifasilitas Public Internet Access sepertiwarnet , cybercafe, hotspot dll. Tempatumumlainnya yang seringdipakaiuntukakses Internet adalahdikampusdandikantor.
  • Disampingmenggunakan PC (Personal Computer), kitajugadapatmengakses Internet melaluiHandphone (HP) menggunakanfasilitas yang disebut GPRS (General Packet Radio Service). GPRS merupakansalahsatustandarkomunikasi wireless (nirkabel) yang memilikikecepatankoneksi 115 kbps danmendukungaplikasi yang lebihluas (grafisdan multimedia). Teknologi GPRS dapatdiakses yang mendukungfasilitastersebut. Pengaturan GPRS padaponseltergantungdari operator yang digunakan. Biayaakses Internet dihitungmelaluibesarnyakapasitas (per-kilobyte) yang diunduh.
  • Layanan yang Disediakanoleh Internet :
    • LayananKomunikasi
      • e-mail
      • USENET Newsgroup(Forums)
      • LISTSERV
      • Chatting
      • Instant Messaging
      • Telnet
      • Internet Telephony
      • Internet Fax
      • Streaming Audio dan Video
      • Real-time Audio dan Video
  • LayananPerolehanInformasi

(Information Retrieval Services)

    • File Transfer Protocol (FTP)
      • Archie
      • Gophers
      • Veronica (Very Easy Rodent Oriental Netwide Index to Computer)
      • Wide Area Information Server (WAIS)
    • Web Services
  • Dapatdisimpulkanbahwapadazamandahulubekomunikasisangatsulit, berbedadenganzamansekarangini. Perkembanganteknologikomunikasisangatpesatdansangatmudah. Hampirsemuaorangsekarangdapatberkomunikasidengancepatdanmudah. Sesuaidenganperkembanganzamanteknologikomunikasisemakinberkembangdanterusberkembang.
  • Dalamkesempatan kali ini, kamihanyadapatmenyerahkanbahwapergunakanlahteknologidengansebaiknya, janganpergunakanuntukberbuatjahatdanmerusak moral anakbangsa.
  • Adanya lab komputerdisekolahuntukpraktek TIK, agar pelajarbisalebihmemahamitentangteknologiinformasi yang mendalamdankhususnyapelajaran TIK karenasekaranghanyabanyakmateri yang membuatpelajartidakmengerti.
daftar pustaka
  • http://ml.scribd.com/doc/24127490/MAKALAH-perkembangan-teknologi
  • http://id.wikipedia.org/wiki/Teknologi_informasi
  • http://makalahkumakalahmu.net/2009/03/18/pemanfaatan-teknologi-informasi-dan-komunikasi-sebagai-media-pembelajaran/
  • http://ml.scribd.com/doc/24946950/Pengertian-Teknologi-Informasi
  • http://www.google.co.id/#hl=id&biw=1440&bih=714&sa=X&ei=EcAQUNXuPIarrAfquoHIAQ&ved=0CEsQBSgA&q=komputer+generasi+ketiga+dalam+bentuk+power+point&spell=1&bav=on.2,or.r_gc.r_pw.r_qf.,cf.osb&fp=93d99ac811d5ed06
  • http://jelitasarismansaku.blogspot.com/2012/05/tik-kelas-x.html
  • http://www.slideshare.net/jumiathyasiz/pertemuan-1-sejarah-komputer-10626615
  • http://hends25.blogspot.com/2011/06/makalah-tik-smp-2011.html