PENGANTAR ILMU MAKANAN TERNAK UNGGAS - PowerPoint PPT Presentation

hang
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
PENGANTAR ILMU MAKANAN TERNAK UNGGAS PowerPoint Presentation
Download Presentation
PENGANTAR ILMU MAKANAN TERNAK UNGGAS

play fullscreen
1 / 36
Download Presentation
PENGANTAR ILMU MAKANAN TERNAK UNGGAS
994 Views
Download Presentation

PENGANTAR ILMU MAKANAN TERNAK UNGGAS

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. PENGANTAR ILMU MAKANAN TERNAK UNGGAS IlmuMakanan : Ilmu yang berhubungandenganbahanmakanandanzat-zatmakanan yang terkandungdidalamnya, dalamhubungannyadengankesehatanmanusiadanhewan Zatmakanan : Kombinasisenyawakimia yang digolongkanmenurutsifat- (nutrien) sifatfisik, kimiadanbiologis BAHAN MAKANAN PANGAN/FOOD PAKAN/FEED untukmanusiauntukhewan Ransum/diet/ration: susunanbahanmakanan/pakan [komposisitertentu]

  2. PENGGOLONGAN ZAT-ZAT MAKANAN : Air Karbohidrat Protein Lemak Vitamin mineral FUNGSI ZAT MAKANAN DAN SUMBER UTAMANYA DALAM RANSUM AYAM AIR:merupakankomponendarahdancairantubuh, pencernaan, transport makanandansisapencernaan, pengatursuhutubuh, Sumber: air minum, air dalambahanmakanan

  3. KARBOHIDRAT ( seratkasar + BETN) : - panas, energi, produksilemak - Sumberenergimudahdicerna  BETN : sumberenergiutama  Seratkasar : ayamkurangmampumencernaseratkasar, berfungsi mencegahpenggumpalanmakanandalam saluranpencernaan Sumber : jagung, beras, gandum, sorgumdanhasilikutanpengolahannya: dedakpadidedakgandum/pollard Starch/pati: biji-bijiandanumbi ---------- sangatfundamental Sugars: buah-buahandanmolases --------- secondary role Cellulose: batang-batangtanaman --------- undigested

  4. PROTEIN • pertumbuhandanpenggantianjaringan • pembentukantelur, aktivitassperma • - panas, energi, produksilemak • [Kekuranganenergi ----- protein akandirubahmenjadienergi] • Protein ataunitrogenous substances merupakanunsurpenting yang membangun organ-organ tubuhmahlukhidup • - Pemberiandanpenggunaannyasangatpenting • - Menjadisubjek-subjekberbagaipenelitian

  5. Protein disusundarigugusasam amino, yaitu: (1) asam amino esensial, dan (2) asam amino non-esensial Asam amino asensial---- karenahewanmonogastriktidakdapatmensintesanya, sehinggaharusditambahdariluarmelaluimakanan Asam amino non-esensial---- karenaasam amino inidapatdisintesaolehhewandariasam-asam amino lainnya Sumber : Protein hewani ; tp. ikan, tp. cacing, tp. bekicot / keongmas tp. pupa, sisarumahpotong, dll.

  6. Sumber : Protein nabati : bkl. kedelai, bkl. kacangtanah, bkl. Kelapa, dll. Protein nabati Tidakmengandungasam amino yang lengkap ----- biasanya kekuranganasam amino metionin, lisin, dantriptofan Protein hewanikebalikannya dikombinasikan [untukmenghasilkanasam amino yang sesuaidengankebutuhan] Contoh: untukayam broiler penggunaanbungkilmaksimum 49% [menghindarikekuranganasam amino]

  7. LEMAK • - SumberenergidanCadanganpanas • Padaternakdidepositdalambentuklemakhewan (lemak abdominal, lemakperiveral) • Ketersediaannyadalampakanunggaskecil (lemakhewan, lemaknabati) • Sumber : • - minyakkelapa, lemakhewan • Karbohidratdanlemak ---- sumberenergiuntukfungsi-fungsi yang vital (bergerak, aktivitasmakan, pertukaranpanas)

  8. VITAMIN Pertumbuhan, kesehatan, asimilasi mineral, dayatetas, fertilitas, nafsumakan, pencernaan, pembentukantulangdanbulu Sumber :tepunghijauan, jagung, feed suplement MINERAL Pembentukankerangka, pembentukankerabang, menjagamengaturkenetralantubuh Sumber :tepungikan, susu skim, tp. tulang, tp. kulitkerang, tp. kerabang, tpkapur (CaCO3), DikalsiumPhosfat (DCP), feed suplement Mineral Calcium (Ca) dan Phosphorus (P) --- sangatsedikittersediapadabahanmakananasalnabati Mineral trace elements: manganese, iron, copper, cobalt, iodine dan zinc

  9. Feed suplement: bahanberupazatmakanan yang ditambahkankedalamransum, contoh :asam-asam amino, mineral mikro, vitamin Feed additive : bahanbukanzatmakanan yang ditambahkan kedalamransum, contoh :coccidiostat, antibiotik, antioksidan, probiotik Zat Toxic: perludiwaspadai ---- pemberianbahantersebutpada unggasharushati-hati (dibatasi, diolah) Contoh:hydrocyanic acid padaubikayusegar ; gossypol padabijikapasdanbungkilbijikapas ; danbeberapa alkaloids padabijileguminosatertentu

  10. KEBUTUHAN ENERGI DAN PROTEIN PADA AYAM Syarat lain: - Seratkasarmaksimum 7% - Lemakmaksimum 8% PenyusunanRansumUnggas (Ayam) Faktor-faktor yang perludiperhatikandalammenyusunransum: Umur (starter, grower, layer) dantipeayam (berat, medium, ringan) Bahan-bahanpakan yang tersedia Tabel-tabelberisiinformasitentangkandunganzat-zatmakanansertarekomendasikebutuhanakanzat-zatmakananuntuksetiapfaseumurdantujuanproduksi  Tabel: Scott (1982, dst), National Research Council/NRC, Hartadidll., HasilAnalisisLaboratorium

  11. KOMPOSISI ZAT-ZAT MAKANAN DALAM BAHAN MAKANAN UNTUK UNGGAS (BERDASARKAN KERING UDARA), SCOTT (1976)

  12. METODE PENYUSUNAN RANSUM Trial and error method : Dihitungsecaracoba-cobasampaididapatkandunganzatmakanan (terutama protein danenergi) sesuaikebutuhan Menggunakanpaket program (linear programing, mixit, excel) Contoh: SusunanRansum AyamPetelur

  13. 3. Square method / metodebujursangkar, hanyadigunakanuntukduamacambahan, dengansyaratkandunganzatsalahsatubahanlebihrendahdan yang lain lebihtinggidaripadakandunganzattersebutdalamransum yang akandisusun. Contoh : diperlukansuaturansumuntukayamburasdengankandungan protein 15%, bahanpakan yang dimilikiadalahdedakpadi yang mengandungprotein 8%dankonsentratdengankandunganprotein 36%. Berapabanyakmasing-masingbahandiperlukanuntukmembuat100 kg ransum: 36 7 (15-8) bag. konsentrat 15 8 21 (36-15) bag. dedakpadi Konsentrat = 7/28 x 100 = 25 kg Dedakpadi = 21/28 x100 = 75 kg

  14. FAKTOR-FAKTOR YANG MEMPENGARUHI KONSUMSI RANSUM Faktorgenetik : bobotbadan, strain, jeniskelamin Temperatur Kandunganenergiransum KandunganSeratKasardalamransum Status kesehatanayam Palatabilitasransum Adanyacekaman/stress

  15. FUNGSI NUTRIEN/ZAT MAKANAN Nutrien yang dicernadigunakanuntukmenjalankanfungsiesensialdalamtubuhyaituhiduppokok (metabolisme, mengatursuhutubuh, pergerakan minimal, menggantidanmemperbaikisel/jaringan) sertauntukproduksi (pertumbuhan, penggemukan, produksitelur) Hiduppokok : Kebutuhanuntukhiduppokokdidefinisikansebagai: Kombinasibeberapanutrien yang dibutuhkanunggasuntukmenjalankanfungsitubuhnyatanpaterjadipertambahan, ataupenguranganbobotbadanmaupunaktivitasproduktif

  16. Faktor-faktor yang mempengaruhikebutuhanhiduppokok : • Fakstoreksternal : dapatdikendalikansampaibatastertentumelaluipengelolaandanpemberianfasilitas : • Aktivitas • Keadaancuaca • Status kesehatandanadanya stress • Faktor internal : • Ukurantubuh • Temperamen • Tingkat produksi • Variasiantarindividu • Pertumbuhan : • Definisi : pertambahanukurantulang, otot, organ dalamdanbagian lain tubuh • Merupakanproses normal sebelumdansesudahmenetashinggamencapaidewasa • Pertumbuhandipengaruhiolehtingkatkonsumsiransum • Kebutuhannutriendiengaruhioleh : umur, jeniskelamin, bangsa, lajupertumbuhan, status kesehatan

  17. Umur Dibandingandenganayam yang lebihtua, umumnyaayammuda : Mengkonsumsiransum per unit bobotbadanlebihtinggi Memanfaatkanransumlebihefesien Membutuhkan protein, energi, vitamin dan mineral perunitbobotbadanlebihbanyak Membutuhkanransum yang padatgizidanmudahdicerna Lebihsensitifterhadapdefesiensinutrien Bangsa Bangsaayam yang besartumbuhlebihcepatdaripadabangsa yang lebihkecildanmemerlukanlebihbanyaknutrien JenisKelamin Ayam♂ tumbuhlebihcepatdaripadaayam♀ danmemerlukanlebihbanyaknutrien Ayam♂ yang tidakdikastrasilebihefisienmemanfaatkanransumuntukpertambahanbobotbadandaripadaayam♀ Bobotbadandewasaayam♂ lebihtinggidaripada♀ Ayam♀lebihcepatmencapaidewasakelamindaripadaayam♂

  18. LajuPertumbuhan Intensif breeding mengarahkan agar ayampedagingtumbuhdengancepatdandapatdipasarkanpadausiadinidisertaidenganpenyesuaianransum • Reproduksi • Pemberianransumuntukproduksimemenuhikebutuhanuntukproduksitelur (jumlahdanbobot), kualitas, dayatetas, pengendalian molting sertamengeram • Kebutuhanuntukpetelurkomersilmeliputikebutuhanuntukhiduppokok, pertumbuhanayamdaradanpembentukantelur (ayamdengankemampuanproduksitinggimemerlukanlebihbanyaknutrien) • Petelurpembibitmemerlukan vitamin, A, D, E, B12, riboplavin, asampanthotenat, niacin danMnlebihbanyakdaripadaayampetelurkomersil

  19. PenggunaanNutrien Nutriendigunakanmelaluisalahsatudiantaraduaprosesmetabolikberikut : Anabolik : adalahprosesdimanamolekul-molekulnutriendigunakansebagaibuilding blockunutkmensistesismolekul-molekulkompleks, reaksi-reaksianabolikbersifatendergonicdanmemerlukan input energi Katabailisme : adalahprosesoksidasinutriendenganmembebaskansejumlahenergi yang digunakanuntukmemenuhikebutuhantubuhsaatitu, reaksiinibersifatexergonic

  20. PenentuanKebutuhanAkanNutrien • Kebutuhannutrienditentukandengancaramenemukanjumlah minimal yang harusdisediakan agar fungsifisiologisberkembangmaksimal • (ataudidasarkanpadapertimbanganfaktorekonomissepertipertumbuhan, efesiensipenggunaanransum, produksitelur, dayatetas) • Feeding trial denganbeberapa level nutrien yang bersangkutansampaididapatsuatu level yang tidaklagimenghasilkanpeningkatanpada variable yang diukur • Kebutuhannutriendinyatakan : • Jumlahkebutuhan per hari ransum yang diberikanselama 24 jam jumlahnyatertentu • Konsentrasidalamransum (%, ICU, ppm)  ransumdisediakantanpadibatasi • Kebutuhanzat-zatmakananuntukunggaspadaberbagaifaseumurdantujuanpemeliharaan : tabel NRC, National Academy of sciences

  21. HubunganAntaraNutrienDenganFaktor Lain • Faktorgenetik • Kemampuanmemetabolisenergidanmencernazatmakanantertentu • Kebutuhannutrienuntukhiduppokok • Kemampuanmendefositkannutrienuntukpertumbuhandanproduksitelur • Responterhadapmetabolitdan anti nutrientertentu • Penyakitdan Stress : • Ayammampuberadaptasiterhadap stress kronis yang ringan • Kehadiranparasitdalamsaluranpencernaanmeningkatkankebutuhanakan vitamin B • Coccidiosis, Infectious Bronchitis danInfeksiMycoplasmameningkatkankebutuhanakan Vitamin A

  22. KualitasTelur • Kualitaskerabang : pemberianantibiotikberpengaruhterhadappigmentasiwarnakerabang, ketebalankerabangdipengaruhioleh Ca, P dan Vitamin D • Kualitas albumen : pemberian NH4Cl dapatmeningkatkannilai HU, namundapatmenurunkanketebalankerabangkarena pH darahjugaturun • Defisiensi vitamin A menimbulkan blood spot pada yolk • Bobottelurdipengaruhiolehkecukupan protein, asam-asam amino danasamlinoleat

  23. HubunganTimbalBalikAntarNutrien ImbanganEnergi : Protein Interaksiantara Ca, P dan Vitamin D Hubunganantara niacin dan tryptophan Hubunganantaracholin, methionin, asamfolatdan vitamin B12 dalammetabolismereaksitransmetilasigugusmetil Peranan vitamin E, Selenium dancystinedalammencegahpenyakitexudative diathesis dan muscular dystrophy Chelation effect asam amino dan mineral tertentudalamtransportasinutrientertentu Hubungantimbalbalikantara Cu dengan Zn, Zn denganCd, Cu dengan Mo serta Se denganarsenik Hubungantimbalbalikantara lysine denganarginine, leucinedanisoleucindenganvaline, ketidakseimbangandanantagonismeasam-asam amino tertentu.

  24. Faktor-faktor Yang Mempengaruhi Tingkat KonsumsiRansum : • [ Ayammakanuntukmemenuhikebutuhanenergi] • TemperaturLingkungan • FaktorGenetik • KeseimbanganNutrien • LajuPertumbuhan • Status Kesehatan • BentukFisikRansum • UkuranTubuh • Tingkat ProduksiTelur PengukuranEfesiensiRansum EPR = konsumsiransum / pertambahanbobotbadan x 100% konsumsiransum / produksitelur x 100% Konversiransum = pertambahanbobotbadan / konsumsiransum produksitelur / konsumsiransum (ket : dalamsatuandanjangkawaktu yang sama)

  25. KebutuhanEnergi • Jumlahenergi yang tersediauntukmemenuhikebutuhanbagipertumbuhanatauproduksitelurpadatingkat yang cukuptinggiuntukmendapatkankeuntunganekonomismaksimal • Energi yang dikonsumsidigunakanuntuk : • Aktivitasjantung • Menjagatekanandarahdan tonus otot • Mentransmisiimpulssyaraf • Transportasi ion melaluimembransel • Prosesreabsorpsidalamginjal • Sintesis protein danlemak • Produksitelur

  26. DefesiensiEnergi • Defesiensienergitidakmemperlihatkangejalaspesifiksepertipadadefesiensi vitamin atau mineral sehinggasulituntukdikenalidanbarutampaksetelahberlangsungcukup lama • Akibatdefesiensi : • Pertumbuhanterhambat/kerdil • Kehilanganjaringan • Produksitelurrendah ZatMakananSumberEnergi Karbohidrat : murah, sangatmudahdicerna, diserapdanditransformasimenjadilemaktubuh, tahandisimpan lama Lemak : jumlahpenggunaanterbatas Protein : mahal

  27. Kandunganenergidalamransumsangatmempengaruhijumlahkonsumsi, sehinggakeseimbanganantaraenergidenganzat-zatmakanan lain terutamaasam-asamaminno (protein) sangatpenting • Kebutuhanseekorayamakanenergiditentukanolehlajumetabolik , yang dipengaruhioleh ; • Bangsaatau strain • Aktivitas • Ritme diurnal • Temperaturlingkungan • Tiperansum • Energitinggi : protein tinggi • Energitinggi : protein rendah • Energirendah : protein tinggi • Energirendah : protein rendah • 6. Tingkat produksi

  28. NilaiEnergiPakan : • Energipakandinilaiberdasarkankemampuannyauntukmenyediakanenergibagiternak • Energidibutuhkandalamjumlahbesardibandingkandenganzat-zatmakananlainnyasehinggaseringkalimenjadifaktorpembatasdalamproduksikarenamerupakankomponenbiayaransumtertinggi • Unit energi : • Kalori / calori : banyaknyaenergi yang diperlukanuntukmenigkatkantemperatur 1 gram air sebesar 10C (14,5 – 15,5 0C) • Kilokalori / kilocalories = 1000 kaloriuntuk 1 kg air • Nilaienergiransumdinyatakandalamkkal/kg

  29. SISTEM PENGUKURAN ENERGI PADA AYAM GROSS ENERGY (GE) DIGESTIBLE ENERGY (DE) Fecal Energy APPARENT METABOLIZABLE ENERGY (AME) TRUE METABOLIZABLE ENERGY (TME) Urinary Energy Metabolic and endogeneous energy losses Heat Increment NET ENERGY (NE) • NET ENERGY MAINTENANCE (NEm) • Basal metabolic rate • Activity • Body temperature regulation • NET ENERGY PRODUCTION (NEp) • Eggs • Growth • Feather

  30. Model Pertumbuhan • TubuhKeseluruhan: • Pertumbuhanditandaidenganadanyapertambahanbobotbadan, dengankurvapertumbuhanberbentuk S, pertumbuhanrelatifberhenti / bobotbadanmulaistabilpadasaatdewasatubuh • Bobotbadandewasaditentukanoleh strain danjeniskelaminpada strain yang sama (sexual dimorphism) • Bagian-bagianTubuh : • Pertambahanbobotbadaunggasterdiriataspertambahanbobotmasing-masingbagiantubuhdanlajupertumbuhansetiapbagiantubuhberbeda • Bobotsaluranpencernaandanbagian organ dalam lain secaraproposionalmenurunsejalandenganpertumbuhan • Bobotototdanlemakmeningkatsejalandenganpertumbuhan Mature body weight Maximum growth rate Body weight Age when maximum rate of growth occurs Age

  31. FisiologiPertumbuhan • Pertambahanjumlahdanukuranmasing-masingsel • Komponenpertumbuhan : • Peningkatanbobototot (protein dan air) • Peningkatanukurankerangkauntukmenunjangpertumbuhanotot (mineral terutamakalsium) • Peningkatanpenimbunanlemakpadajaringan adipose (trigliseridadansedikit air) • Peningkatanukuranbulu, kulitdan organ dalam (pada strain ayampedagingpertumbuhannyasangatsedikit)

  32. PertumbuhanOtot : • Peningkatanketebalandanpanjangserabutotot (jumlahnyatelahditentukansebelumayammenetas) • Penebalanototdisebabkanolehterjadinyapembelahandanperbanyakanmyofibril, sedangkanpenambahansarcomerepadaujung-ujungmyofibril menyebabkanserabutototmemanjang • Serabutototayamjantanlebihtebaldaripadabetina • Serabutototayampedagingpertumbuhancepatlebihtebaldaripadaayam yang tumbuhlambat • Pertumbuhanototidentikdenganpenimbunan protein, defesiensi protein akanmenghambatlajupertumbuhan • Interaksikopleksantarahormon-hormondalamtubuhmempengaruhilajupertumbuhanotot

  33. PertumbuhanTulang • Fungsitulang : • 1. Membentukkerangka yang kompakuntukmenunjangotot-otottubuh, • 2. Penyimpanancadangan Ca dan P • Terdiridariduafasematriks : - Ca dan P  kerasdankaku • - Serabutorganik  fleksible • Pertumbuhanmemanjangtulangterjadipadabagian growth plate : sel-selpada growth plate (osteoblast) mensintesisdanmensekresikanosteoid (kolagenkaya protein) yang membentukmatrikstempatabsorpsi ion-ion Ca dan P yang kemudianmembentukkristal • Osteoclastmereabsorpsi mineral danfaseorganiksehinggaukurantulangmembesardanberfungsisebagaicadangan metabolically active Ca • Pertumbuhantulangdipengaruhioleh : faktorgenetik, hormon, kecukupan vitamin A dan D • Kelainanakibatpertumbuhan abnormal tulang : spondylolisthesis, deformasitulang kaki, dyschondroplasia, rickets

  34. PertumbuhanLemak • Terjadidibeberapabagiantubuh, ditimbunpadajaringan adipose yang membentukbantalantrigliseridaberakumulasidalamsel-seljaringan adipose (adipocytes) • Asam-asamlemakdiderivasilangsungdarimakananataudisintesisdalamhatidengangluksasebagaiprekusorberbedadenganmamalia • Berfungsisebagaicadanganenergidaninsulasitubuh • Padadefesiensienergilemakdarijaringan adipose dimobilisasidenganbantuanhormonglukagon.

  35. TERIMA KASIH