Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
PROTEOMICA PowerPoint Presentation

PROTEOMICA

186 Views Download Presentation
Download Presentation

PROTEOMICA

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. PROTEOMICA PROTEOOM = alle proteïnen die tot expressie worden gebracht door het genoom, in een bepaald organel, cel, organisme, of lichaamsvloeistof op een bepaald ogenblik Technieken Tweedimensionele electroforese (Tweedimensionele chromatografie) Massaspectrometrie

  2. 2-D gel electrophoresis Protein separation according to : (1) charge (2) size Protein mixture

  3. HART “mastergel” German Heart Institute Berlin (2002)

  4. Controle Rat serum Acute ontsteking (turpentine) E. Gianazza (2002)

  5. Massaspectrometer Electrospray (ESI) vacuüm ionen bron massa analyzer detector Iontrap

  6. iontrap

  7. electrospray ionenbron 1- 4 kV iontrap + helium

  8. m z

  9. Onze strategie peptiden A B C D E F G Scheiding van eiwitmengsel dmv 2DE gelspot  optimaal slechts 1 eiwit  eiwit in gel  trypsine-behandeling  specifieke knipplaatsen [het maximaal aantal eiwitstukjes (= peptiden) is voorspelbaar] [hoe groter het eiwit, des te meer peptiden ]  complex mengsel  Verdere scheiding van peptidenmengsel dmv chromatografie eiwit trypsine Chromatografie massa- spectrometer peptiden- mengsel A E B F G C ruwe data Stroomrichting over chromatografiekolom

  10. “gewicht” van peptide C Fictief massaspectrum op ogenblik dat peptide C uit de kolom stroomt intensiteit (full scan spectrum) m/z massaspectrum van de kolomuitstroom is weliswaar minder complex maar blijft toch nog te complex voor de massaspectrometer: Kan wel alle ionen die op een bepaald ogenblik uit de kolom stromen “wegen”, maar kan er geen verdere “sequentieinformatie” uithalen, behalve uit de drie meest intense ionen (instrumentele beperking  er gaat mogelijks veel informatie verloren) Sequentieinformatie wordt bekomen dmv fragmentatie van het peptide C ion het bekomen massaspectrum noemt men een fragmentatiespectrum Per full scan spectrum krijgen we maximaal 3 fragmentatiespectra (volledige cycle time: ca 1.5 sec)

  11. Peptide sequentiebepaling met MS/MS NH2 C-R-I-S-T-A-L COOH MS/MS b-ionen y-ionen m/z C-R-I-S-T-A-L 763.67 104.01 660.67 260.11 504.57 373.20 391.49 460.23 304.45 561.27 202.98 632.31 131.94 R-I-S-T-A-L C I-S-T-A-L C-R S-T-A-L C-R-I T-A-L C-R-I-S A-L C-R-I-S-T L C-R-I-S-T-A

  12. Sequentie-ionen P. Roepstorff & J. Fohlman, Biomed. Mass Spectrom. 11, 601 (1984)

  13. chromatogram een parent-ion (één van de vele) m/z = 806.8 z = 2+ (806.8 * 2)-2=1611.2 Da massa neutraal peptide

  14. Parent m/z = 806.8 y9 MS/MS spectrum y6 y8 y12 y5 y7 y3 y10 y11 y4

  15. m/z 1386.4 1271.5 1157.4 971.4 856.2 769.4 670.2 569.1 482.3 381.0 m/z 114.9 115.03 114.1 114.04 186.0 186.08 115.2 115.03 86.8 87.03 99.2 99.07 101.1 101.05 86.8 87.03 101.3 101.05 sequentie D N W D S V T S T Asp Asn Trp Asp Ser Val Thr Ser Thr RHFWQQDEPP QSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNL KLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQ EMSKDLEEVK AKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPL GEEMRDRARAHVDALRTHLAPYSDELRQRL AARLEALKEN GGARLAEYHA KATEHLSTLSEKAKPALEDL RQGLLPVLESFKVSFLSALEEYTKKLNTQ Apolipoproteïne A1

  16. a) Data-acquisitie (software: Xcalibur versie 3.1) 1 ruwe datafile per analyse (per gel spot) b) Dataverwerking Raw datafile-format (bestaande uit full scan spectra en fragmentaitiespectra) dta-file format (alleen fragmentatiespectra) search Sequest Mascot Rapport 1 Rapport 2 (. dat file) (.out file)

  17. Van ruwe data tot identificatie van eiwit

  18. Welke ruwe datafile moet er verwerkt worden ?

  19. Ruwe datafile (verzameling van full scan spectra en fragmentatiespectra) omvormen naar een set bestaande uit enkel fragmentatiefiles = dta-format ( 1 fragmentatiespectrum = 1 dta.file)

  20. search-engine Mascot “publiek”: zonder licentie enkel te bevragen met maximaal 300 dta.files

  21. Na kopieren van merge programma (afkomstig van Mascot-website) in de juiste folder (hier peptide2975 met 299 dta files) wordt 1 grote tekst-file aangemaakt

  22. Text-file aanbieden in Mascot

  23. Welke databank ? Hoe specifiek kan/moet de search zijn? invoeren van text-file

  24. ... en na een 1-2 minuten...

  25. Opnieuw dta-fles aanmaken :omdat a) minimizer had enkel de 300 meest intense fragmentatiespectra weerhouden en b) voor slechts een beperkt gebied van het chromatogram nu verder werken met alle dta-files van het volledige chromatogram