Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
M. Bagus Qomaruddin PowerPoint Presentation
Download Presentation
M. Bagus Qomaruddin

M. Bagus Qomaruddin

266 Views Download Presentation
Download Presentation

M. Bagus Qomaruddin

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. M. BagusQomaruddin

  2. Pengorganisasian & PengembanganMasyarakat Metodepengorganisasianbeberapakegiatanlokaluntukmeningkatkankesejahteraanmasyarakatdenganmelaluikegiatanpemberianpengalamanbelajar

  3. PengembanganMasyarakat (Community Development) Suatugerakan yang dirancanguntukmeningkatkantarafkehidupanmasyarakatdenganpartisipasiaktif, danjikamemungkinkan, denganprakarsadarimasyarakattetapijikaprakarsainitidakmunculsecaraspontan, perludigunakanteknik-teknikuntukmenumbuhkannya, demiuntukperkembangandankemantapanmasyarakatitusendiri

  4. notes • Prakarsa artinya tindakan mula-mula oleh masyarakat untuk menyelesaikan masalahnya sendiri. • Contoh : AC kelas mati, lalu ada seorang anggota kelas yang inisiatif untuk bergerak. Maka hal itu sudah disebut prakarsa • NB : yang difont merah, penting dan intinya

  5. PemberdayaanMasyarakat Upayamemberikankemampuanpadamasyarakatdengandisertaiprosespembelajaran, denganpengambilkeputusanutamamasyarakatsendirisehinggamasyarakatdapatmengeloladirinyasendiri, mengatasimasalahnyasendiri, tanpatergantungpadapihak lain. Kalaupunperlubantuanpihak lain ituhanyasebagaipelengkap.

  6. PengorganisasianMasyarakat (Community Organization) Suatuprosesdimanamasyarakatmelakukanidentifikasikebutuhan, membuaturutanprioritasnya, menumbuhkankemauandan rasa percayadiridalammemenuhikebutuhannyatadi, mencarisumber-sumberbaik yang adadimasyarakatmaupun yang berasaldariluardanmelakukantindakan-tindakanuntukmemenuhikebutuhantadisambilmemperluasdanmengembangkankerjasamadalammasyarakat.

  7. Tambahan PJMK • CD dan CO bedanya hanya di proses tetapi tujuannya sama. • CD lebih ke desa sedangkan CO lebih ke masyarakat kota. Namun prinsipnya sama yaitu mengembangkan potensi lokal.

  8. CO dan CD melahirkan matkul PPM • PPM : Metode pengorganisasian beberapa kegiatan lokal untuk meningkatkan kesejahteraan masyarakat melalui kegiatan pemberian pengalaman belajar yang berdaya • Masyarakat berdaya : mampu mengatasi masalahnya sendiri

  9. Unsur Program PengembanganMasyarakat • Program terencana yang terfokuspadakebutuhanmenyeluruhmasyarakat • Mendorongswadayamasyarakat • Adanyabantuanteknisdaripemerintahataulembagaswasta • Mempersatukanberbagaispesialisasi

  10. Swadaya masyarakat : membantu mendorong. Sehingga lebih merasa memiliki hasil dari prosesnya. • Contoh : Uang hasil kerja sendiri walau kecil akan lebih berharga daripada pemberian orang tua saja.

  11. TujuanPemberdayaanMasyarakatdalamBidangKesehatan • Memperkuatgayahidupsehat (Tidak BAB dikali, donor darah, olahraga, tidak bergadang) • Memampukanwargauntukmemobilisasikekuatansosial • Menciptakankondisi yang kondusifpadakehidupansehat • Meningkatkankemandirianmasyarakatdankeluargadalambidangkesehatan

  12. Empowerment Domain (Laverack) • Community participation • Problem assessment • Local leadership • Organisational structures • Resource mobilization • Link with others • Ability to ask ‘why’ • Program management • Role of the outside agent

  13. notes • Com. Participation : partisipasi aktif • Problem assesment : membuat masyrakat mampu menilai masalah sendiri • Local leadership : harus ada kepala , tdk bisa berjalan sendiri. contoh : tokoh masyarkat, (kades, kiai) potensi ini harus dikembangkan. • Org. Structure : deskripsi struktur yg jelas & pmbgian tanggung jawab yg jelas • Resource mobilization : berkaitan dngn mencari 6 M, 2 T, 1 I (Man, Machine, Money, Method, Market, Material, Time, Technology, Information) • Link with other :mutlak harus ada, jngn smpai diisolir • Ability to ask why : merupakan pertanda masy. Sudah berdaya. Harus berani bertanya mengapa ? • Prog. Management : paling penting , metodenya POACE • Role of the outside agent : perlu bantuan dari pihak luar. Sehingga masyarakat lebih bergairah. Ex : media

  14. TIGA TAHAPAN PEMBERDAYAAN Penyadaran Pengkapasitasan Pendayaan

  15. notes • Penyadaran : Menyadarkan bahwa masyarakat butuh • Pengkapasitasan : memberikan kapasitas kpd masyarakat. Ex : tempat, alat, orang, nilai, budaya. Contoh program dilatih cara menanam, disediakan tempat juga dan diberi aturan mainnya (program lengkap) • Pendayaan : masuk kegiatan pemberdayaan

  16. Empowerment Element (Narayan) Access to Information Inclusion and Participation Accountability Local organizational capacity

  17. notes • Access to information : jika belum dapat mengkases informasi berarti belum berdaya • Inclusion & participation : siapa yg melakukan dan bagaimana menggerakkan? • Accountability : semua yg dilakukan terukur dan terbuktu • Local org. Capacity : mengembangkan kapasitas org. Lokal ex : PKK, Karang Taruna

  18. BeberapaPrinsipPemberdayaanMasyarakat • Menumbuhkembangkanpotensimasyarakat • Kontribusimasyarakatdalampembangunankesehatan • Mengembangkangotongroyong • Bekerjabersamamasyarakat • KIE berbasismasyarakatdanormaslainnya • Desentralisasi (didasarkan oleh kebutuhan masyarakat)

  19. Pemberdayaan Sebagai program Sebagaiproses

  20. notes • Sebagai program : hanya satu kali selesai • Sebagai proses : berlangsung pembelajaran seumur hidup Ex : Posyandu Apa yang dilakukan ? Berapa meja ? Siapa ? Yang diberdayakan adalah ibu2, untuk mengetahui tumbuh kembang anak

  21. Terima Kasih