20 likes | 33 Views
Anti-PTPLAD1 polyclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-PTPLAD1-PAb-190363-147.htm<br>
E N D
Anti-PTPLAD1 (aa 1-113) polyclonal antibody Anti-PTPLAD1 (aa 1-113) polyclonal antibody (DPAB-DC2183) (DPAB-DC2183) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description PTPLAD1 (protein tyrosine phosphatase-like A domain containing 1) is a protein-coding gene. Diseases associated with PTPLAD1 include hepatitis c, and hepatitis. GO annotations related to this gene include lyase activity and GTPase activator activity. An important paralog of this gene is PTPLA. Immunogen Immunogen HSPC121 (NP_057479, 1 a.a. ~ 113 a.a) partial recombinant protein with GST tag. The sequence is MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDL VKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDE Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Conjugate Conjugate Unconjugated Applications Applications WB (Recombinant protein), ELISA, Size Size 50 μl Buffer Buffer 50 % glycerol Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION GENE INFORMATION Gene Name Gene Name PTPLAD1 protein tyrosine phosphatase-like A domain containing 1 [ Homo sapiens (human) ] Official Symbol Official Symbol PTPLAD1 Synonyms Synonyms PTPLAD1; protein tyrosine phosphatase-like A domain containing 1; HACD3; B-IND1; HSPC121; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3; hB-ind1; butyrate- induced protein 1; butyrate-induced transcript 1; 3-hydroxyacyl-CoA dehydratase 3; protein tyrosine phosphatase-like protein PTPLAD1; protein-tyrosine phosphatase-like A domain- containing protein 1; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
Entrez Gene ID Entrez Gene ID 51495 mRNA Refseq mRNA Refseq NM_016395 Protein Refseq Protein Refseq NP_057479 UniProt ID UniProt ID Q9P035 Chromosome Location Chromosome Location 15q22.2 Function Function GTPase activator activity; lyase activity; protein binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved