program linear contoh contoh model n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Program Linear: Contoh-contoh Model PowerPoint Presentation
Download Presentation
Program Linear: Contoh-contoh Model

Loading in 2 Seconds...

play fullscreen
1 / 23

Program Linear: Contoh-contoh Model - PowerPoint PPT Presentation


  • 244 Views
  • Uploaded on

Program Linear: Contoh-contoh Model. s. Contoh Model Kombinasi Produk.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Program Linear: Contoh-contoh Model' - ciel


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
contoh model kombinasi produk
Contoh Model KombinasiProduk

Perusahaan inisudahdikontrakuntukmembuatkausstandardengangambartimpemenanagpadasuatukompetisisepak bola antaruniversitas. Kaus yang diproduksimencakup 2 jeniskauslenganpanjang, satudengangambardisisidepandansatulagigambardiduasisidepanbelakang, danduajeniskauslenganpendekdenganbentukgambarserupa. Perusahaan harusmenyelesaikanseluruhproduksinya 72 jam setelahpertandinganusaidanharustepatpadawaktunya.

slide3

Trukpengangkutmemilikikapasitasmuatansebanyak 1.200 kardusukuranstandar. Satu box ukuranstandarberisi 12 kauslenganpendek, sementarasatukardusberisiselusinkauslenganpanjangberukuran 3x lebihbesar. Perusahaan memilikidana $25.000 untukmemproduksikaus. Perusahaan jugamemiliki 500 lusinkauslenganpendekdan 500 kauslenganpanjangpolos yang siapdisablon.

jawaban
Jawaban
  • Variablekeputusan
  • Masalahinimemilikiempatvariabelkeputusan yang mencerminkanjumlah (dalamlusin) tiapjeniskaus yang akandiproduksi

x1 = kaoslenganpanjang, gambarsisidepan

x2 = kaoslenganpanjang, gambarduasisi

x3= kaoslenganpendek, gambarsisidepan

x4= kaoslenganpendek, gambarduasisi

  • Fungsitujuan
  • Maksimalkan Z = $90 x1 + 125 x2 + 45 x3 + 65 x4
  • Batasan model
  • 0,1 x1 + 0,25 x2 + 0,08 x3 + 0,21 x4 ≤ 72
  • 3x1 + 3x2 + x3 + x4 ≤ 1.200
  • $36 x1 + 48 x2 + 25 x3 + 35 x4 ≤ 25.000
  • x1 + x2 ≤ 500
  • x3+ x4 ≤ 500
  • x1 , x2 , x3 , x4 ≥ 0
contoh model program diet
Contoh Model Program Diet
  • Breathtaker, suatupusatkesehatan, menjalani program olahragapagiuntukparamanula. Program inimencakuplatihan aerobic, berenangatau ban jalan, diikutidenganmakanpagisehatdiruangmakan. Ahligizibreathtaker, inginmengembangkan menu makanpagiyang kaya akankalori, kalsium, protein, danserat yang diperlukanparamanula, jugarendahlemakdankolesterol.
slide8

Iajugainginmeminimalkanbiaya. Iatelahmemilihkemungkinanjenismakananberikut, yang masing-masingmengandungkontribusigizidanbiaya yang berbedauntukmengembangkan menu makanpagistandarpadatabelberikut :

slide9

Ahligizitersebutmenginginkanporsisarapan yang mengandung paling tidak 420 kalori, 5 miligramzatbesi, 400 mg kalsium, 20 gr protein dan 12 gram serat. Iajugainginmembatasikandunganlemaktidaklebihdari 20 gram dankolesteroltidaklebihdari 30 mg

jawaban1
Jawaban
  • Variablekeputusan

x1 = sereal bran dry per cangkir x6 = daging per iris

x2 = sereal dry per cangkir x7 = jeruk

x3= buburgandum per cangkir x8 = susu per cangkir

x4= oat brand per cangkir x9 = jus jeruk per cangkir

x5 = telur x10 = rotipanggang per iris

  • Fungsitujuan
  • Maksimalkan Z = 0.18x1 + 0,22x2 + 0,10x3 + 0,12x4 + 0,10x5 + 0,09x6 + 0,40x7 + 0,16x8 + 0,50x9 + 0,07x10
  • Batasan model
  • 90x1 + 110x2 + 100x3 + 90x4 + 75x5 + 35x6 + 65x7 + 100x8 + 120x9 + 65x10 ≥ 420 kalori
  • 2x2 + 2x3 + 2x4 + 5x5 + 3x6 + 4x8 + x10 ≤ 20 grkalori
  • 270 x5 + 8x6 + 12x8 ≤ 30 grkolesterol
  • 6x1 + 4x2 + 2x3 + 3x4 + x5 + x7 + x10 ≥ 5 mg zatbesi
  • 20x1 + 48x2 + 12x3 + 8x4 + 30x5 + 52x7 + 250x8 + 3x9 + 26x10 ≥ 400 grkalsium
  • 3x1 + 4x2 + 5x3 + 6x4 + 7x5 + 2x6 + x7 + 9x8 + x9 + 3x10 ≥ 20 gr protein
  • 5x1 + 2x2 + 3x3 + 4x4 + x7 + 3x10 ≥ 12 grkalsium
contoh model investasi
Contoh Model Investasi
  • Kathleen Allen mempunyaidana $70.000 untukdibagidalambeberapabentukinvestasi. Pilihaninvestasiadalahobligasipemerintahdengantingkatpengembalian8,5%, sertifikatdepositodengantingkatpengembalian10%, treasury bills dengantingkatpengembalian 6,5% danobligasipendapatandengantingkatpengembalian 13%. Jumlahwaktusampaijatuh tempo samauntuksetiappilihan. Akantetapi, setiappilihaninvestasimempunyaiperbedaanresiko. Berikutinipedoman, yang ditetapkanuntukmelakukandiversifikasiinvestasidanmengurangiresiko yang terlihatoleh investor.
  • Tidaklebihdari 20% dari total investasidalambentukobligasiPEMERINTAH.
  • Jumlah yang diinvestasikandalamsertifikatdepositotidakbolehmelebihijumlah yang diinvestasikandalamketigapilihan yang lain.
  • Paling sedikit 30% investasiharusdalamweselbayar (treasury bill) dansertifikatdeposito
  • Agar aman, perbandingkaninvestasipadasertifikat deposit dan treasury bills denganinvestasidalamobligasipemerintahdansahamharus paling tidak 1,2 : 1

Kathleen merencanakanuntukmenginvestasikanseluruh $70.000

jawaban2
Jawaban
  • Variablekeputusan

x1 = jumlah ($) yang diinvestasikandalamobligasipemerintah

x2 = jumlah ($) yang diinvestasikandalamsertifikatdeposito

x13= jumlah ($) yang diinvestasikandalam treasury bill

  • x14= jumlah ($) yang diinvestasikandalamsaham
  • Fungsitujuan
  • Maksimalkan Z = $0,085x1 + 0,1x2+ 0,065x3 + 0,130x4
  • Dimana
  • Z = total pengembaliandarisemuainvestasi
  • 0,085x1 = pengembalianinvestasidalamobligasipemerintah
  • 0,05x2 = pengembalianinvestasidalamsertifikatdeposito
  • 0,065x3 = pengembalianinvestasidalam treasury bills
  • 0,130x4= pengembalianinvestasidalamsaham
jawaban3
Jawaban
  • Batasan model
  • Investasidalamobligasipemerintahtidakbolehmelebihi 20% dari total investasi
  • x1 ≤ 14.000
  • Jumlah yang diinvestasikandalamsertifikatdepositotidakbolehmelebihijumlah yang diinvestasikandalamtigapilihaninvestasi lain.
  • x2 ≤ x1 + x3 + x4
  • x2 – x1 - x3 - x4 ≤ 0
  • Paling sedikit 30% dari $70.000 adalah $21.000 dan x2 = x3 merupakanjumlah yang diinvestasikandalamsertifikatdepositodan treasury bills
  • x2 + x3 ≥ $21.000
jawaban4
Jawaban
  • Batasan model
  • Perbandinganantarajumlah yang diinvestasikandalamobligasipemerintahdanjumlah yang diinvestasikandalam treasury bill paling tidak 1.2 : 1
  • [(x2 + x3 )/(x1 + x4 )] ≥ 1,2
  • x1 + x4 ≥ 1,2 (x1 + x4 )
  • -1,2x1 + x2 + x3 – 1,2x4 ≥ 0
  • Investor inginmenginvestasikanseluruh $70.000 dalamkeempatpilihan
  • x1 + x2 + x3 + x4 = $70.000
contoh model pemasaran
Contoh Model Pemasaran

Jaringantokoserbaada The Biggs menyewaperusahaanperiklananuntukmenentukanjenisdanjumlahiklan yang harusdiperolehuntuktoko. Tigajenisiklan yang tersediaadalahiklankomersil radio, televisi, daniklansuratkabar. Jaringantokoinginmengetahuijumlahsetiapjenisiklan yang harusdibelidalamrangkamemaksimalkantujuannya. Berikutiniperkiraansetiapiklankomersil yang akanmencapaipemirsapotensialdanbiayatertentu.

slide19

Batasaansumberdaya:

  • Batas anggaranuntukiklanadalah $100.000
  • Stasiuntelevisimempunyai 4 waktukomersil
  • Stasiun radio mempunyai 10 waktukomersil
  • SuratKabarmempunyaijatah yang tersediauntuk 7 iklan
  • Perusahaan iklanhanyamempunyaiwaktudankaryawanuntukmemproduksi
  • Jumlah total komersialdaniklantidakdapatmelebihi 15 karakterkarenaketerbatasaniklan
jawaban5
Jawaban

VariabelKeputusan

Model inimemilikitigavariabelkeputusan :

X1 = jumlahiklankomersiltelevisi

X2 = jumlahiklankomersil radio

X3 = jumlahiklansuratkabar

FungsiTujuan

Untukmasalahinitujuan target pemirsaataupembacadiperolehdarimenjumlahkanpemirsaataupembacasetiapiklan.

Memaksimalkan Z = 20.000 X1 + 12.000 X2 + 9.000 X3

Dimana, Z = jumahpemirsa/pembaca

20.000 X1 = perkiraanjumlahpemirsa yang dicapaiolehkomersialtelevisi

12.000 X2 = perkiraanjumlahpemirsa yang dicapaiolehiklan radio

9.000 X3 = perkiraanpembaca yang dicapaiolehiklansuratkabar

jawaban6
Jawaban

Ringkasan Model

Model program linear padamasalahiniadalah :

Memaksimalkan Z = 20.000 X1 + 12.000 X2 + 9.000 X3

Batasan

15.000 X1 + 6.000 X2 + 4.000 X3 ≤ 100.000

X1 ≤ 4

X2 ≤ 10

X3 ≤ 7

X1 + X2 + X3 ≤ 15

X1 + X2 + X3≥ 0

resources
Resources
  • Taylor W. Bernard. 2004. Management Science Eight Edition. Prentice Hall : New Jersey
  • wikipedia.org