1 / 6

Comparative Analysis of OsMIPS1 and OsMIPS2 Gene Families in Rice

This study delves into the characterization of OsMIPS1 and OsMIPS2 genes in rice, shedding light on their structural and functional differences. The findings offer valuable insights into the molecular mechanisms underlying plant metabolism and stress responses.

cathal
Download Presentation

Comparative Analysis of OsMIPS1 and OsMIPS2 Gene Families in Rice

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. TaMIPS1 TaMIPS1 TaMIPS1 TaMIPS1 TaMIPS1 TaMIPS1 TaMIPS1 TaMIPS1 TaMIPS1 TaMIPS2 TaMIPS2 TaMIPS2 TaMIPS2 TaMIPS2 TaMIPS2 TaMIPS2 TaMIPS2 TaMIPS2 Supplementary Fig. 1

  2. 4 5 6 7 8 9 1 2 3 10 LOC_Os03g09250.1/OsMIPS1 LOC_Os03g09250.2/OsMIPS1-1 LOC_Os03g09250.3/OsMIPS1-2 LOC_Os03g09240.4/OsMIPS1-3 LOC_Os10g22450/OsMIPS2 At4g39800/AtMIPS1 5 6 7 1 4 2 3 At2g22240.1/AtMIPS2 At2g22240.2/AtMIPS2-1 At5g10170/AtMIPS3 Supplementary Fig. 2

  3. GCC BOX MYB1AT CCAAT BOX1 MYC MYBPLANT ABRE GTGA motif CArG motif TATCCA RY repeat Dc3 GCN4 motif GT-1 motif E1RE Hexamer motif W BOX ASF1 motif -1000 -800 -600 -400 -200 +1 Os3g09250 Os10g22450 At2g22240 At4g39800 At5g10170 Supplementary Fig 3

  4. At2g22240.1 At2g22240.2 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 5 5 5 5 5 5 5 5 5 5 5 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 At5g10170 8 9 2 2 At4g39800 8 2 2 9 Os03g09250.1 Os03g09250.2 2 2 2 8 8 8 9 9 9 9 9 9 2 2 2 Os03g09250.3 8 9 9 8 2 2 2 2 Os03g09250.4 Os10g22450 2 8 9 9 2 8 2 Ta MIPS1 Ta MIPS2 2 9 9 2 2 2 8 8 Supplementary Fig. 4

  5. MOTIF 6 width = 15 sites = 39 llr = 964 E-value = 8.4e-183 MOTIF 1 width = 28 sites = 28 llr = 1507 E-value = 4.3e-369 GNNDGMFLAAPQTFRAKEISWGTKKDQM FHEFHHVDHPHVYWT MOTIF 2 width = 21 sites = 32 llr = 1184 E-value = 6.6e-257 WRAMDEYTMRACMGLAPTNNC MOTIF 3 width = 29 sites = 21 llr = 1322 E-value = 1.5e-325 MOTIF 8 width = 29 sites = 6 llr = 472 E-value = 4.8e-084 CEDMNLAAPMIRDRVLDAELQTQIQPYME MOTIF 7 width = 21 sites = 14 llr = 615 E-value = 1.4e-107 MOTIF 4 width = 41 sites = 13 llr = 1108 E-value = 4.1e-214 PFINGSPQNTFVPGLIELAIRKNCLIGGD QANYYGSLTQASTIRVGSYNGEEIYAPFKSLYPMFCPLQGV MOTIF 9 width = 15 sites = 14 llr = 443 E-value = 1.3e-067 EIHSDYQYDTTERVHEQHDGA MOTIF 5 width = 29 sites = 19 llr = 1194 E-value = 2.2e-278 KAPQVPPYTHVYCAW SWQTKMKSVRYDFRTGAGIKPTSIMSWNH Supplementary Fig 5

  6. Supplementary Fig. 6

More Related