Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
Realita Kehidupan PowerPoint Presentation
Download Presentation
Realita Kehidupan

Realita Kehidupan

622 Views Download Presentation
Download Presentation

Realita Kehidupan

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. RealitaKehidupan Di zaman seperti sekarang ini, kita dihadapkan pada perubahan yang sangat cepat,Persaingan dan tuntutan hidup yang semakin tinggi. Permasalahan selalu muncul dan harus dihadapi sehingga bila tidak memahami hakikat hidup,esensi masalah, jadilah kita seperti LAYANGAN PUTUS

  2. RealitaKehidupan “ Siapa yang dapat menentukan dimana suatu BERAKHIR dan yang lain BERAWAL “-SunTzu-

  3. RealitaKehidupan “Kosongkan dulu pikirananda dariego,kesombongan dan cara berpikir anda untuk mencapai tingkat tertinggi bidang HIDUP yang anda pilih “

  4. Perubahan SaatnyaperubahanhidupAnda. Mari menjadi yang terbaikBersamaKami BerubahSekarangatauTidakSamaSekali !!!

  5. InikahHarapandanImpianAnda ? Ibadah BerkendaraanbersamaKeluarga RumahKeluarga Deposito 5 Milyar

  6. ProfesiTermahal HariGinimasihNegatif ?? KasianDeh…

  7. Tujuanberbisnis MLM FAKTANYA ??

  8. Tujuanberbisnis

  9. Tujuanberbisnis Why ?

  10. Tujuanberbisnis Bobotpencapaianhasilsangatberat. Tidakadakerjasamaantaraperusahaandan member (HASIL). Tidakadakerjasamaantara member upline & downline (teamwork) / SUPPORT SYSTEM yang terintegrasi. SIKAP MENTAL member yang bergabungbelumdipersiapkan.

  11. Saatnyaperubahan !! Mengapaharus BISA ?

  12. Company Profile PT. BINTANG INDONESIA SEJAHTERA ABADI RukoMutiaraFaza Blok RA/9. Jl. Raya Condet No.27 – Jakarta Timur. Gaga Sarwono Owner BISA

  13. Pernah tak anda mendengar tentang CATUABA ?

  14. CATUABA adalahtumbuhanajaib yang berasaldariLembah Amazon Brazil, iaadalahtumbuhanafrodisiak Brazil yang paling terkenal. Beberapaabad yang lalu, Suku Indian Tupi yang tinggaldisini, darigenerasikegenerasitelahmenemuikeberkesanandankeajaibanekstraktumbuhan CATUABA yang mampumemperbesarukuran organ sex laki-laki. Itulahsebabnyakenapamerekamempunyaibuahzakaryang besardankuathinggamendatangkanirihatikepadasemualelaki-lelakididuniaini.

  15. Melaluiproses, suku Indian inijugamenemukanbahwaseoranglelaki yang mengkonsumsiCATUABA untukjangkawaktu yang lama mampubertahanselamalebihdaripada 2 jam tanpaejakulasidanmasihmempunyaitingkatkesuburanyang lebihtinggidankekuatansekssepertimereka yang berusia 25 tahunwalaupundiusia 60 tahun. CATUABA adalahsejenistumbuhan yang telahmemilikikhasiatdahsyatuntukmembesar organ sex laki-lakidenganluarbiasasertameningkatkandayasexsyang sangathebatbagipenggunanya.

  16. Suku Indian Tupi (Brazil) telahmenggunakan CATUABA bagigenerasitidakterkirabanyaknya. Sebagaibukti, parailmuwantelahmenelitibahwa rata-rata laki-lakiSukuTupimemilikiukuran organ vitalnyasepanjangn 20 cm (8 inci). Bahkanuntukmemudahkanmerekaberburu, merekaterpaksamengikatorgan vital merekadisekelilingpinggangataupaha. Olehsebabitu, merekajugadiberigelarsuku Indian yang UNIK: “SUKU INDIAN GAJAH AMAZON”.

  17. Para Penelitiresmi Negara Brazil, Para AkademikPenyelidikanObat-obatanAmerikaSerikatdan Para penelitiIlmuReproduksidari University HARVARD – USA jugatelahmelakukanpenyelidikanhadapkaumlaki-lakiSuku Indian Tupidan CATUABA. MichealVan Straten, seorangpakardariInggrisyang terkenaldidalampenyelidikantumbuh-tumbuhanobatberkata : Inimerupakansalahsatukemajuandanpenemuanbarudalambidang DISFUNGSI EREKSI. Dan lagitidakadaefeksamping yang disebabkanolehpenggunaan CATUABA dalammasa yang panjang.

  18. 10 MANFAAT CATUREX: 1. Membantulaki-laki yang inginmemilikiukuranalat vital yang besar, panjangsertakeupayaanseks yang kuat. 2. Membantumemperbesarukuran organ sekslelaki 3. Memberikanlelakibadan yang sangatkuat, sehatdanbertenaga 4. BISA MENGATASI EjakulasiDini (ED), ejakulasipramatang (PE) dandisfungsiseksuallelaki. 5. Menyeimbangkanhormontubuhmanusiadanmenggalakanrembesanhormonlelaki. 6. Menggalakanperedarandarah, mencegahpenyakitkardiovaskular 7. Merawat HIPERPLASIA PROSTATIK BENIGNA (BPH) dankerapmembuang air kecilpadawaktumalam. 8. Meningkatkansistemimunisasibadan 9. Memperbaikimasalahkeletihandankebimbangan 10. MenguatkandayaingatanwalaulanjutUsia....

  19. Catuabayang dikandungdidalam CATUREX merupakanasimilasidariilmukunodan modern dilengkapidenganpenelitianilmiah yang sudahterbukti. Iniadalahobat herbal asli yang pekatdanampuh. Melaluiteknologipengekstrakandanpengolahan yang eksklusiframuanaktifdidalamnyadapatdipertahankanhingga 100%. Formula khususdanistimewainimerupakanrahasiakeberhasilannyadalammemberikanhasil yang begitumenakjubkan. Memangprodukiniadalahsuatuproduk yang terbaikdanterungguldipasaran. Berdasarkansuatu survey, kalanganpriadewasasaatinimengalamiberbagaijenismasalahkesehatan, dimanatingkatkesehatanmerekaSemakinMenurunsetiapharinya. Hal initelahmenjadisuatuancaman yang akhirnyaakanmengakibatkankesakitandankesusahan yang berlarut-larutdalamsaat yang diperlukan.

  20. Saw Palmettoadalahsalahsatukandungandidalam CATUREX yang adalah: sejenistanamanaslididaerahpantaiAmerikaSerikatbagian Selatan dan California Selatan. Herbal inisangatluarbiasauntukpriadanwanita. OlehpraktisimedisuntukmerawatberbagaijenispenyakitsepertiradangbuahZakar, radangsalurankencing, batukdansesaknapas. Dapatjugadigunakanuntukmemperkuatkelenjartiroid, menyeimbangkanmetabolisme, merangsangseleramakandanmembantupencernaan. Herbal yang hebatiniterkenaljugakarenapenggunaannyadalampertumbuhanrambut, kesehatanprostat, memperbaikifungsiseksualdanpembesaranpayudarasertadikenalsebagaitonikberkhasiat. Herbaiinijugamenyegarkanuretrasertadigunakanuntukmempertahankanfungsisehatkelenjartiroiddan system urinari.

  21. Cordycepsadalahsalahsatukandungan CATUREX yang adalah: jamurmedis yang jugadikenalsebagaijamur caterpillar atauchongcao, jamurinibanyakdimanfaatkanuntukpengobatan, salahsatunyaadalahuntukmemperbaikikerusakanhati. Cordycepsjugasejenisantioksidandansesuaisebagaimakanantambahanuntukkesehatanhati, ginjalsertaparu-paru. EkstrakBijiLabumemilikibanyakmanfaatuntuktubuhmanusia, halinitelahditemukansejakzamanpurbaolehsuku-sukudipedalamanAmerika Utara. Kandungannyaterdiridariberbagaijenis vitamin, zat mineral, serat, lemakdan protein yang pentingdalammeningkatkankesehatantubuh

  22. CATUREX jugamengandung ingredient yang sangatbergunauntuk KESEHATAN para LAKI-LAKI seperti: Peach Fruit, Apple Powder, TribulusTerrektris, Horny Goat (TandukRusa), Fruktosa. CATUREX SANGAT DIBUTUHKAN OLEH SEMUA LAKI-LAKI…TANPA MEMANDANG SUKU, JABATAN dan UANG. JIKA MAU SEHAT SAMPAI TUA …. TANPA EFEK PAKAI CATUREX !!!!

  23. FUNGSI UTAMA CATUREX • Menjadikantubuhlebihkuat, sehatdanbertenaga. • Memperlancarperedarandarah, mencegahpenyakitkardiovaskuler. • Mengurangikolesteroldarah. • Meningkatkanmetabolisme. • Meningkatkan system kekebalantubuh. • Meningkatkanfungsihati, ginjaldanparu-paru. • Anti radang. • Merawathyperlass prostatic benigna (BPH) danmengurangifrekwensibuang air kecildimalamhari. • Memperbaikikualitasseksual. • Meningkatkanprosentasekesuburan. • Meningkatkanpertumbuhanototdankekuatantubuh. • Memperbaikimasalahkeletihandankecemasan. • Meningkatkandayaingat. • Membantumengurangi stress. • Mencegahkencingmanis.

  24. Produk BISA

  25. Collacelladalahsebuah PADUAN PRODUK MUTAKHIR dan GABUNGAN antara: Colagen Glutation, dan SteamCell Yang diproduksikhususuntuk BISA (Bintang Indonesia Sejahtera Abadi)

  26. COLLAGEN Kolagenadalahsalahsatu protein yang menyusuntubuhmanusia. KeberadaanKolagendidalamtubuhmanusiaadalahkuranglebihmencapai 30% dariseluruh protein yang terdapatditubuh. Kolagenadalahstrukturorganikpembanguntulang, gigi, sendi, ototdankulit. Seratkolagenmemilikidayatahan yang kuatterhadaptekanan. KatakolagensendiriberasaldariBahasaYunani yang artinya (bersifatlekatataumenghasilkanpelekat).

  27. Fungsi COLLAGEN JadifungsiKolagenuntuktubuhmanusiaadalah: menjagaketerikatanantarasatuseldengansellainnyaditubuhmanusia. Dayarekatinilahsebenarnya yang menentukanketahanantubuhseseoranguntukbisatetap SEHAT sampaiusia TUA. Semakinusiamanusiamengalamipeningkatan, produksi KOLAGEN tubuhcenderungmenurun, karenafungsi HORMON PERTUMBUHAN yang jugamenurun.

  28. Fungsi COLLAGEN Mau tidakmau, setujutidaksetuju, akhirnyasesuaidenganperkembanganzaman, manusiaharusmemasok “DAYA REKAT” tersebutdengan NUTRISI yang LUAR BIASA dan BERTEKNOLOGI TINGGI.

  29. STEAM CELL Selindukyang terdifirensiasiselbiologis yang dapatmembedakandalamselkhususdandapatmembagi (melalui MITOSIS) untukmenghasilkanselinduklebih. MerekaditemukandimultiselulerOrganisme.Padamamalia, adaduajenisluasselinduk: SelIndukEmbrionik, yang terisolasidari Massa SelBagianDalamdariBlastokista, danSel-selIndukDewasa, yang ditemukandiberbagaijaringan. PadaorangdewasaOrganisme, sel-selbatangdanSel Progenitor bertindaksebagaisistemperbaikanuntuktubuh, pengisianjaringandewasa.

  30. STEAM CELL Dalamembrioberkembang, selindukdapatberdiferensiasimenjadisemuaselkhusus-ektoderm, endoderm dan mesoderm (lihatpluripotentselindukdiinduksi, tetapijugamempertahankanomset normal organ regeneratif, sepertidarah, kulit, ataujaringanusus.

  31. STEAM CELL AdatigasumberdiaksesdiketahuidariAutologusSelIndukDewasapadamanusia: Sumsumtulang, yang memerlukanekstraksidenganpanen , yaitupengeboranketulang (biasanya femuratauiliac crest), Jaringanadiposa (sellemak), yang memerlukanekstraksidengansedotlemak, dan Darah, yang memerlukanekstraksimelaluiApheresis, dimanadarahdiambildari donor (miripdengan donor darah), danmelewatisebuahmesin yang ekstrakselindukdanmengembalikanbagian lain daridarahuntuk donor.

  32. Glutathion Glutathion(bahasaInggris:glutathione, GSH) adalahTripeptidaIntraselularberbentuk Gamma-Levo-glutamil-L-sisteinil-glisina, denganberbagaikegunaan, antara lain, Detoksifikasi, Antioksidan, pemeliharaanstatustioldanmodulasiproliferasisel. GSH biasanyaberbentukmolekulreduksitiol yang disebut GSH, danbentukdisulfidateroksidasi. Konsentrasi GSH tertinggiterdapatdidalamHATI. GSH telahdikenalsebagaikofaktoranti OkasidanterhadapSpesiOksigenReaktifdansenyawa Lipid Hidropeoksida, denganEnzimGlutathionPeroksidasedangolonganGlutathion S Transferase.(GST).

  33. Glutathion Meskipunbeberapaspesireaktifdapatmembentukadductsecaralangsungterhadap GSH, umumnyareaksi adduct tersebutterjadidengansenyawa GST sebagaikatalisator.Senyawajenisthiadiazabicyclo-ONE-GSH (TOG) yang merupakanadduct GSH dengan4-hydroperoxy-2(E)-nonenal (ONE) merupakanprodukterbanyak yang terbentuksepanjangStresOksidatif yang dimediasioleh Fe(II) atauPeroksidapadaSelEndotelial, keduajenissenyawa TOG merupakanadduct GSH denganAsamDioksododesenoatdanAsamDioksooktenoat, duasenyawa yang diturunkandari terminus karboksiLipid Hidroperoksida. leukotrienajugamerupakansenyawaadduct GSH.

  34. ManfaatCollacell: Sebagai ANTI OKSIDAN Alami yang bisamenghambat PROSES PENUAAN DINI. Sumber KOLAGEN ALAMI untukmemperkuatseltubuhmanusiasehinggabisamemperkuat SEL manusiahinggatua. Mencerahkan KULIT wajahdankulitseluruhtubuhmanusia. Memperlancarsistem METABOLISME TUBUH manusia.

  35. Marketing Plan Bagaimanacarabergabung? DenganmembayarPaket : • Rp. 1.800.000,- Andatelahmenjadi Member “BISA” yang memilikihak: • Mendapatkan 1 Paket Produk • MendapatkanHak Usaha • Bonus – Bonus, dan Reward BISA

  36. System BISA • Bergabung Rp.1.800.000,- mendapatproduksenilai Rp.3.000.000,- • BONUS dibayar HARIAN (TanpaSyarat) • Tidak “TUPO” (Tutup Point) • HU (Hak Usaha) sekaliseumurhidup. • HU dapatdiwariskan. • POSTING Internet 24 Jam. • Pembayaran BONUS darihariSenin – Jumat. (Sabtu – minggudibayarhariSenin).

  37. BONUS SPONSOR Anda C A Rp. 300.000 Rp. 300.000 B Rp. 300.000

  38. BONUS PASANGAN LEVEL Paket Daftar: Rp. 1.800.000 Anda Rp. 500.000 A C No Risk B D Rp.500.000 No Flush Rp. 500.000 E F Rp. 500.000 H G J

  39. BONUS PASANGAN BISA Anda Potensi Income Rp. 1.500.000/Hari/HU Rp. 150.000 Rp. 150.000 Rp. 150.000 Rp. 150.000 Rp. 150.000

  40. BONUS AUTO CLONING UP Sampai anda 6 Anda 3 Anda 2 Rp. 500.000* Anda 1 Rp. 500.000* Rp. 500.000 Rp. 500.000 Rp. 500.000 45 45