slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Anti Viral DrugS & DISINFECTANS / ANTISEPTICS PKH UB, SM IV 2013 PowerPoint Presentation
Download Presentation
Anti Viral DrugS & DISINFECTANS / ANTISEPTICS PKH UB, SM IV 2013

Loading in 2 Seconds...

play fullscreen
1 / 41

Anti Viral DrugS & DISINFECTANS / ANTISEPTICS PKH UB, SM IV 2013 - PowerPoint PPT Presentation


  • 189 Views
  • Uploaded on

Anti Viral DrugS & DISINFECTANS / ANTISEPTICS PKH UB, SM IV 2013 Lecturer : Drh . Pambangun M Bangun_vet@yahoo.com. ANTI VIRAL DRUG. Anti Viral Drugs adalah obat obatan yang digunakan pada pasien yang terinfeksi virus.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Anti Viral DrugS & DISINFECTANS / ANTISEPTICS PKH UB, SM IV 2013' - avak


Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide1

Anti Viral DrugS & DISINFECTANS / ANTISEPTICS

PKH UB, SM IV 2013

Lecturer : Drh. Pambangun M

Bangun_vet@yahoo.com

slide3

Anti Viral Drugs adalahobatobatan yang digunakanpadapasien yang terinfeksi virus.

Penggunaanobat anti viral pd kedokteranhewanmasihterbatas, tetapipenelitianmengenaiobat anti viral untukbinatangygterinfeksi virus banyaksekali yang sedangdilakukansaatini

Saatiniobat anti viral ygdigunakanutkhewanmasihobat anti viral ygdipakaiutkmanusia

slide4

Anti Viral :

  • * pengobataninfeksi virus padamata
  • * nonneoplastic Feline Leukimia Virus (FeLV) danpenyakitygberhubungan
  • Anti Viral  Topical danSistemik

Anti viral lain ygmungkinbisadipakaidalamduniakedokteranVeteriner :

-amantadin

-ganciclovir

-idoxuridine

-azidothymidine

slide5

Acyclovir

Contoh : zovirax tablet, zoviraxcapsul, zoviraxinj

zoviraxsuspensi, Valacyclovir

(semua human label)

slide6

Interferon alfa -2A

  • Kucing non neoplasticFeLV Disease , PO
  • Belumadalaporanttg side effect nya
  • Obat patent : Roferon-A
slide7

Disinfectans

&

Antiseptics

slide8

Disinfectans & Antiseptics

perbedaanantaradisinfectans & antiseptics tdkjelas

beberapa antiseptics ygtdkdilarutkanbisaberfungsisbgdisinfectans, beberapa disinfectants ygdiencerkanbisasbg an tiseptics

slide9

Disinfectansdan antiseptics adalahbahanbahankimia yang bisadigunakanuntukmengontrolperkembanganmikroba

Usaha mengontrol perkembanganmikrobabisadgncara:

  • Cleanser (surfactans, detergent) , membersihkankotoranygterkontaminasiolehmikroorganismetdkmembunuhataumencegahmultiplikasinya.
  • Sterilisasi (membasmisemuabentukmikroba, termasuk yang membentukspora , mis B. anhracis)
  • Disinfeksi (membasmimikrobavegetatif/ygtdk membentukspora) skr juga yg membebtuk spora
slide10

Asepsis (usahamencegahterjadinya sepsis/pembusukan, meminimalkankontaminasimikrobapenyebabpembusukan, mis pd prosespembedahanselaintempatjugaperalatan, personildanpasien)

  • Sanitasi(usahautkmenurunkanjumlahmikroba, meminimalkanpenularanpenyakitkemanusia,hewan,ternak yang satukeyg lain)
  • Antisepsis (prosesdisinfeksiygdilakukan pd jar. hidup)
  • Degerming (prosesmekanikutkmenghilangkanmikroba pd area tertentu)
  • Bakteriostatik(usahamenghambatmultiplikasibakteri, bilabahanbakteriostatikatdkdiberikanlagimakabakteriaakantumbuhkembali)
slide11

Dalampraktek Antiseptics adalahbahan yang diaplikasikandibagianluartubuhhewanataumanusia , padajaringanhidup, untukmembunuhataumencegahmultiplikasimikroorganismepenyebabinfeksi (bacteri,virus, jamur,protozoa,dll)

Disinfectanslebihtoksikbiladiaplikasikanlangsungpadatubuh, tetapisangatbergunautkmembasmimikroorganismepatogenygterdapatpadapermukaanbendamati , mis. bangunan, kandang, alattransportasi, peralatanbedah, peralatankandang, ruangandll.

slide12

1)Gol. Oksidator :

a) Peroksida

b) Potasiumpermanganat

c) Halogen

2) Gol. Reduktor

a) Sulphurdioksid

b) Formaldehid

klasifikasidisinfectans / antiseptics ,

secarakimiawi

3) Gol. Methalic compound:

4)Gol. Asamdan alkalis

5)Alkohol

6)Phenol, Cresol, Xylenol

7) Organic Compound yg lain

8)Dye

9) Detergent

slide13

1.> bahankimiaygmerusakmembran plasma :

phenol,cresol,hexachlorophen, chlorhexidin, ethanol, isopropanol,quartenarry ammonium

2.>bahankimiaygmerusakenzym :

iodine, chlorine, hydrogen peroxide,mercurichloride,silver, zinc

Berdasarmekanismekerja

3.>bahankimiaygbereaksidgngugusfungsional protein : ethylene oxide, propylene oxide,formaldehid, glutaraldehde

slide14

Factor ygmempengaruhiefektififitasdisinfektans/antiseptics :

  • konsentrasi,

konsentrasiygtepat

belumtentuyglebihpekatlebihefektif

  • temperatur (hub dgnpenyimpanan)
  • pH (pH pelarut , air dgn pH ygtepat)
  • Kontaminasi

Type organisme (sensitivitas, bacteri, fungi, virus)

slide15

Penggunaan Antiseptics pd kedokteranhewan:

  • Skin cleanser (surfctans/detergents)
  • Treatment of open wound
  • Teat of antiseptic /post milkingIMI (Intra Mammary Infection)
  • Mouth wash
  • Uterine Irrigant

PenggunaanDisinfectans pd kedokteranhewan:

  • Ygumumdigunakan (kandang, breeding farm, hatchery, kendaraanpeternakan , ketikaada outbreak, dll)
  • Aplikasispesifiksesuaiperaturan , pd area ygmemproduksimakanan

(perusahaanmakanan/minuman)

alcohol
alcohol

beberapaalkoholmempunyaisifatgermisidal, tetapihanya ethyl alcohol 70% (ethanol) dan isopropyl alcohol 50% ygseringdigunakan

keduanyamembunuhvegetatif cell , tdkmembunuhbacteriberspora

keduanyamelarutkanlemakdanmenyebabkandenaturasi protein.

 mekanismekerjanyadgnmelarutkan lipid cell membrane danmembuatterjadinyadenaturasi membrane cell protein

bilakonsentrasiditingkatkan  dehydrasi protein cell  resistensiefekdenaturasi protein

alcohol1
ALCOHOL
  • Spektrum : vegetatifbacteri Gram positif
              • Gram negatif , tdkutkbacteripembentukspora
              • Bacillus tuberclosis
              • Beberapa fungi
              • Beberapa virus, pd prinsipnya envelope virus ygmengandunglemak, cytomegalo virus, herpes simplex dan human immunodefisiency viruses
alcohol2
ALCOHOL
  • Aplikasi pd kulitygbersihsangatefektif., bilakulitterkontaminasibahan organic seperti excreta, mukusdandarahefektifitasthdmikroorganismeakanturundrastis
  • Padakulitcepatmembuatkering. Utkmemperlambatcepatkeringnyabisaditambahglyserin.
  • Korosif pd permukaan metal.
  • Mudahterbakar
alcohol3
ALCOHOL
  • Etanolsebagaiprofilaksissebelumtindakanpembedahan
  • Etanoltdkutklukaterbukakarenamenimbulkan rasa pedihdanmemperberatlukakarenaakanterbentukkoagulan/penjendalandanakanmenyebabkankumantumbuhdibawahnya
  • Sbg antiseptics dansbgpembersihseringdikombinasikandgnaceton
phenol
Phenol
  • Termasuk antiseptics ygsudah lama
  • Cukuptoksikpadapemakaianlokaldanbisamenyebabkankeracunansistemik
  • Tdk lama dipakaisbg antiseptics
  • Kerjanyamenyebabkankeracunanpadacytoplasmadgnjalanpenetrasidanmerusakdindingselmikroba
  • Komersialmengandungsatuataulebihsenyawaygmengakibatkankerjasynergis M.tuberculosis
phenol1
PHENOL
  • Sodium –O-phenylphenolefektif :
  • Staphilococcus
  • Pseudomonas
  • Mycobacteria
  • Lipophilic virus
  • Ascaris
  • Strongylus
  • Trichuris
kresol
KRESOL
  • Mekanismekerja = phenol
  • Toksisitaslebihrendah
  • Bacterisidallebihkuatdp phenol, tapipemakaiannyadgnkonsentrasitinggi
  • Kurangefektifthd virus
  • Tdkefektifthdspora
  • LarutanKresol + sabun LYSOL, lebihmudahlarutdgn air
  • Tdkutk dairy cattle (baumasukkedlm air susu)
formaldehyde glutaraldehyde glt
Formaldehyde & Glutaraldehyde (GLT)
  • Formalin adalah :

Larutanygmengandungtdklebihdari 37% gas formaldehyde

Kerjanyabereaksidgngugusfungsionaldari protein mikroorganisme,

Efektifthdbacteri, fungi dan virus, tetapilambatdayakerjanya, memerlukanwaktu 6-12 jam contact time

formaldehyde glutaraldehyde glt1
FORMALDEHYDE & GLUTARALDEHYDE (GLT)
  • JugaefektifthdM.tuberculose, bacteriberspora, jua virus ygmenyebabkansakitpadahewan., mis. Foot & Mouth Disease (FMD)
  • Kerjanyatdkdipengaruhiolehbahanorganik, relatiftdkkorosifthd metal, cat dankain
  • Formaldehyde biladikombinasikandgn alcohol bisautksterilisasiinstrumenbedah
  • FORMALIN biladicampurdgn POTASSIUM PERMANGANAT  fumigasigedung , kandangkosong (tdkadaternak), gudang
formaldehyde glutaraldehyde glt2
FORMALDEHYDE & GLUTARALDEHYDE (GLT)
  • GLT dialdehydejenuh, miripdgn formaldehyde, ygefektifitasbacterisidal, virusidal , fungisidaldansporisidalnyalebihbagusdp formaldehyde
  • Aktifitasbiocidalnyaberhubungandgnkemampuandalamprosesalkilasithdsulfhidryl, hydroxyl, carboxyl, dankelompok amino ygberpengaruhthd DNA, RNA dansintesa protein
  • Contact time < 2 menitutkvegetatif bacteria
  • 10 menitutk fungi, 3 jam utkbacteriberspora
formaldehyde glutaraldehyde glt3
FORMALDEHYDE & GLUTARALDEHYDE (GLT)
  • Selamamengaplikasikanaldehydesupayamemakai masker dan gloves
chlorine
chlorine

Larutandgnbentukkimia Sodium Hipochlorideatau calcium hypochloridedan Organic Chlorine (Chloramin T)

Aktifitasgermisidalnyadgnjalanmelepaskan chlorine bebasdariformasihypochloride acid dalam air

mekanismekerja , memghambatreaksienzymatissel,

denaturasi protein, danmenginaktivasiasamnukleat

  • Bacterisidal
  • Fungicidal
  • Virucidal
  • Protozoacidal
chlorine1
CHLORINE
  • Pemakain Chlorine sangatterbataskarena
  • Tdkstabilthdsinar, harustersediadlmkeadaanbarutiap kali pakai
  • Bausangatmenyengatwalaupunkeadaantertutup
  • Tdkdirekomendasikanutk antiseptic, karenasangatmengiritasikulitdanjaringan , dan lama sembuhnya
  • Korosifthdlogam,
  • Merusakkain
iodine
iodine

Mekanismekerjamasukkedalamseldgnmempengaruhireaksimetabolismedanmerusakstrukturjugasintesa protein danasamnukleat

aktifmembasmibakteri Gram pos/Gram neg, bacteriygmembentukspora, jamurdanbermacammacam virus

Tdklarut air, tersediadalamalkoholbentuktinctura, berbaudankorosifthd metal

Lebihefektifbilalarutan 1-2% iodindicampurdgn 70% ethyl alkohol Contact time 3 menit 90% bacteria terbunuh

lebihefektifdp. Alkoholsendiri.

iodine1
IODINE
  • Iodine Tinctura :.
  • > mengiritasi
  • > alergy
  • > korosifthd metal
  • > padakulit,bajumembekasseperti cat
  • >pedihbiladiaplikasikanpadalukaterbukadanmembahayakanjaringanhospes
iodine2
iodine
  • Untukmengurangiefekygtdkdiinginkantetapimasihmempertahankanefektifitasnyadalammembunuhmikroba dibuat iodine yglebihjinak (tame iodine) , ygdisebutiodophor.
  • Preparatiniterbuatdari iodine yang dilarutkandgnsurfactan, ygakanmembiarkanterpisahkan
  • Aplikasisecarakontinyuakanmelepaskanperlahan iodine bebasutkmembasmimikroba.
iodophor
IODOPHOR
  • IODOPHOR
  • PembawamolekulnyaPolyvinylpyrrolidone (PVP IODINE) atau POVIDON IODINE (PI)
  • mempunyaiaktifitasyghampirsamadgnbentuklarutan
  • Kurangmengiritasi
  • Kemungkinanreaksialergyberkurang
  • Kurangkorosif
  • Tdkmeninggalkanbekaspadakain (mudahhilangbekasnya)
  • Aktifitasyg lama setelahaplikasi > (4-6) jam
iodophor1
IODOPHOR
  • Sediaanlarutan 10%
  • Larutanpembersih 2%
  • AerosolSpray 2%
  • Salep 2%
  • Obatkumur 2%
  • Aerosol foam 2%
  • Gel vagina 2%
chlorhexidine chx
CHLORHEXIDINE (Chx)
  • CHX adalah synthetic cationic compound, membunuhbakteridgnmerusakdindingseldanmenyebabkanpresipitasi sel.
  • Derivatbiguanidygbersifatbacterisidal, thdbakteri Gram pos/Gram neg,
  • Beberapa Gram negresisten, bisautk fungi, kurangutkyuberculosedanlemahutk virus
  • Indeksterapitinggi, tetapefektifmeskipunadasabun, nanahdandarah
  • Toksisitasrendah, tapipemakaianberulangpadakulitbisamenyebabkanfotosensitisasi
  • Obatkumur,presurgical,wound flush, teat dip.
quartenarry ammonium
QUARTENARRY AMMONIUM
  • Mekanismekerjadgnmengubahpermiabelitasmembran sel.
  • Efektifutkbakteri Gram pos.,dan Gram neg., walaupunadabeberapakuman Gram negygresisten, Pseudomonas cepacia, Pseudomonas aurigenosa
  • Efekmeningkatbiladitambahdgnetanol.
  • Tidakmengiritasi
  • Efekdptdihambatbahanorganik, detergent
quartenarry ammonium1
QUARTENARRY AMMONIUM
  • Desinfeksi peralatan medis yg bukan lensa
  • Tdk utk virus, seperti Parvovirus
  • Contoh : Benzalkonium Chloride (BKC)
  • Benzetonium Chloride
  • Setildimetil benzil chlorid
  • Setilpiridinium
ethylene oxide
ETHYLENE OXIDE
  • Berbentuk gas
  • Mekanisme kerja dgn membuat labil atom Hydrogen pada gugus alkyl sel
  • Membasmi bacteri, fungi , virus
  • Bisa mengiritasi paru paru dan pada kulit bisa terbakar
  • Bila akan melakukan sterilisasi dgn Ethylrne Oxide harus sesuai dan memperhatikan standard OSHA (Occupational Safety and Health Adimistration)
ethylene oxide1
ETHYLENE OXIDE
  • Sterilisasi peralatan seperti matras, semua yg terbuat dari karet, lensa,buku, kertas , plastic
hydrogen peroxide
HYDROGEN PEROXIDE

H2O2 mudah berubah menjadi O2 dan H2O.

Kurang berwarna, sedikit berbau, dgn rasa yg khas

H2O2 yg dipakai pada jaringan akan mengalami dekomposisi, (melepaskan O2)dgn adanya enzym katalase dalam sel dan efek biosidalnya akan tercapai

Hydrogen Peroxide 1,5% utk obat kumur

Bisa utk membasmi spora Anthrax

yg perlu mendapat perhatian sebelum menggunakan disinfectans antiseptics
Yg perlu mendapat perhatian sebelum menggunakan disinfectans/antiseptics :
  • Efektifutkmicroorganismeapasaja
  • Pengencerantepat > konsentrasidisinfektansmempengaruhikelompokkerja
  • pH pengencer/pelarutmempengaruhikerjadisinfektans
  • Bersihkandulu, barudidisinfeksi > efektif