pembentang norman hisham anas redzuan bin shariff n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF PowerPoint Presentation
Download Presentation
PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF

Loading in 2 Seconds...

play fullscreen
1 / 51

PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF - PowerPoint PPT Presentation


  • 279 Views
  • Uploaded on

KOLEJ VOKASIONAL KEMENTERIAN PENDIDIKAN MALAYSIA. PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF. PENDAHULUAN.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF' - aquarius


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
pembentang norman hisham anas redzuan bin shariff

KOLEJ VOKASIONAL

KEMENTERIAN PENDIDIKAN MALAYSIA

PEMBENTANG

NORMAN HISHAM

ANAS REDZUAN BIN SHARIFF

slide2

PENDAHULUAN

Aspirasi Program TransformasiKerajaandan Model BaruEkonomiberhasratuntukmerealisasikanrakyatnyamenjanaekonomiberpendapatantinggi. Modal insan yang berkeupayaanuntukberinovasidanmenerokabidang-bidangbaharudalamusahamenjanakekayaannegaraperludiwujudkan.

PerdanaMenteri

  • BahagianPendidikanTeknikdanVokasional, telahdipertanggungjawabkanuntukmelaksanakantigaperkaraiaitu:
  • Meningkatkanenrolmendalampendidikanvokasional .
  • Merombakkurikulumpendidikanvokasionalsupayarelevandengankeperluanindustri. dan
  • Meningkatkankolaborasidenganpihakindustri.
slide3

Kementerian Pelajaran Malaysia (KPM) menstruktur semula sistem pendidikan menerusi Transformasi Pendidikan Vokasional (TPV) adalah bertepatan bagi mengangkat martabat pendidikan vokasional sebagai aliran pendidikan yang akan menjadi pilihan pelajar

  • Transformasi pendidikan vokasional ini diperlukan untuk menyediakan tenaga kerja terlatih yang berkemahiran bagi memenuhi keperluan negara untuk memasuki pasaran pekerjaan.
  • Memartabatkan pendidikan vokasioanal ini akan mempercepatkan lagi usaha untuk menyediakan tenaga kerja yang kebolehan, berkemahiran dan berpendapatan tinggi bagi menjadikan Malaysia dapat merealisasikan sebagai sebuah negara maju dalam tahun 2020
kolej vokasional
KolejVokasional

Semua sekolah menengah vokasional di Malaysia akan bertukar kepada sistem Kolej Vokasional bermula pada tahun 2013.

Kolej Vokasional bermula pada tahun 2013.

  • Sebagaijalanpintaskeperingkat diploma selepastingkatantiga
  • Menekankanamalanindustriatauamaliteknikaldanmengurangkankomposisiakademik
  • Kurikulumnya merujuk kepada Piawaian Kemahiran Guna Tenaga Kebangsaan (NOSS), SKM dan lain-lain bentuk pensijilan yang diiktiraf oleh pihak industri.
  • Kolej Vokasional menekankan “Soft Skills” supaya pelajar bukan hanya cemerlang di dalam kemahiran mereka malah gemilang di dalam faktor “persembahan diri” dan komunikasi.
slide6

OBJEKTIF PENUBUHAN KOLEJ VOKASIONAL (KV)

  • Menghasilkanlepasanpendidikan KV yang memilikisijilkemahiranatau diploma yang diiktirafolehkerajaandanbadan-badanpensijilankebangsaan.
  • Menghasilkan 20 peratuslepasanpendidikan yang bersediamelanjutkanpengajianvokasionalkeperingkat yang lebihtinggi.
  • Menghasilkanlepasanpendidikan KV yang mempunyaitahapkebolehpekerjaan yang tinggi. Di sasarkanseramai 70 peratusdaripadagraduanakanmendapatpekerjaan di industri.
  • Menghasilkan 10 peratuslepasanpendidikan KV yang berupayamenjadiusahawan yang berdayasaing.
  • MemperkasakansistempenyampaianKementerianPelajaran Malaysia untukmelaksanakantransformasivokasional.
slide7

HALA TUJU PENDIDIKAN VOKASIONAL

Transformasikearah

mencapai status negara

maju.

slide8

DUNIA PEKERJAAN

INSTITUSI PENDIDIKAN TINGGI

INSTITUSI PENDIDIKAN TINGGI

VOKASIONAL

DUNIA PEKERJAAN

INSTITUSIVOKASIONAL

POLITEKNIK

&

INSTITUSI TEKNIKAL

SKM 4

SKM 3

SKM 2

SKM 1

Diploma

Sijil

LAIN-LAIN KEMENTERIAN

ILKA

Diploma

Sijil

KPM

(AKTA PENDIDIKAN 1996)

KOLEJ VOKASIONAL

MATRIKULASI

Bridging

STPM

SPM

MENENGAH ATAS (2 TAHUN)

60%

(2020)

PMR

MENENGAH RENDAH (3 TAHUN)

PENDIDIKAN ASAS VOKASIONAL

SKM 2

SKM 1

5%

95%

UPSR

PENDIDIKAN RENDAH (6 TAHUN)

slide9

KONSEP KOLEJ VOKASIONAL KPM

Period

Duration

Outcome

Assessment

Methodology

Institution

Stream/Field

Voc : Academic

Certification

Industrial Training

Medium of Instruction

Other Languages

slide12

BerikutadalahmerupakanKolejVokasional yang menjadiperintisdantelahdilaksanakanpadatahun 2012

1. KolejVokasionalArau

2. KolejVokasional Sungai Petani 1

3. KolejVokasionalBalikPulau

4. KolejVokasional Seri Manjung

5. KolejVokasional Shah Alam

6. KolejVokasional ERT Setapak

7. KolejVokasionalDato’ Lele Maharaja

8. KolejVokasionalDatukseriMohdZin

9. KolejVokasionalKluang

10. KolejVokasionalMuadzam Shah

11. KolejVokasional Kuala Terengganu

12. KolejVokasionalPengkalanChepa

13. KolejVokasional Kuching

14. KolejVokasional Beaufort

15. KolejVokasional Labuan

slide18

Jenis Program Ditawarkan Di Kolej Vokasional

Terdapattiga program yang ditawarkandi KV iaitu:

a) Diploma Vokasional Malaysia (DVM)

b) Program LatihanKemahiran (SKM)

c) Program Apprenticeship atau Mode SLDN

slide19

Diploma Vokasional Malaysia (DVM)

  • Program sepenuhmasaselamaempattahundanmenjalanitigabulan “On Job Training” diindustri
  • Satu tahun pengajian dibahagikan kepada dua semester dan satu semester pendek
  • Semester pendek mengandungi latihan pratikal, entrepreneurship, pendidikan berasaskan produk (PBE), trainneeship dan modul-modul tertentu mengikut keperluan
  • Tahunsatudantahunduadikenalisebagaipra-diploma manakalatahuntigadantahunempatadalahpringkat diploma
  • Komposisi pembelajaran yang merangkumi 30 peratus akademik dan 70 peratus kemahiran
  • Pelajardiperolehi Diploma Vokasional Malaysia (DVM) dalamtempohempattahunpengajian
slide20

Program LatihanKemahiran (SKM)

  • Tempohpengajianadalahduatahunhinggatigatahun
  • Pelajar melaksanakan program SKM sepenuhnya di Kolej Vokasional dan menjalani tiga bulan “On Job Training” di industri
  • Komposisi pembelajaran yang merangkumi 20 peratus akademik dan 80 peratus kemahiran.
  • Menekankan pendidikan berasaskan produk (PBE), School Enterprise (SE) dan Competency-Based Education and Training (CBET).
  • Setelah tamat pengajian, pelajar dianugerahkan sijil kemahiran malaysia atau juga sijil agensi latihan lain
slide21

Program Apprenticeship atau Mode SLDN

  • Temph pengajain Program Apprenticeship atau Mode Sistem Latihan Dual Nasional (SLDN) selama dua tahun
  • Pelajar akan belajar 30 peratus teori di Kolej Vokasional manakala 70 peratus amali dilaksanakan di industri
  • Memperolehi Sijil Pelajaran Aliran Kemahiran (SPAK) yang dikeluarkan oleh Lembaga Peperiksaan dan Sijil Kemahiran Malaysia (SKM) tahap 2 dan tahap 3
slide22

SISTEM SEMESTER PROGRAM SIJIL & DIPLOMA KV

NOTA : SISTEM FLEXIBEL YANG MEMBOLEHKAN PELAJAR MENAMATKAN PENGAJIAN DALAM TEMPOH 3 ½ TAHUN ATAU 4 TAHUN

pembangunan kurikulum kolej vokasional
PEMBANGUNAN KURIKULUM KOLEJ VOKASIONAL
  • Transformasi pendidikan vokasional yang bermula pada tahun 2013 memberi penekanan kepada amalan industri atau amali teknikal dan akan mengurangkan komposisi akademik.
  • Kurikulumnya merujuk kepada Piawaian Kemahiran Guna Tenaga Kebangsaan (NOSS), SKM dan lain-lain bentuk pensijilan yang diiktiraf oleh pihak industri.
  • Pendidikan dan latihan vokasional sememangnya mempunyai peranan cukup penting dalam menyediakan laluan utama ke arah melahirkan modal insan yang berkemahiran tinggi seterusnya menyumbang kepada penjanaan kekayaan baru bagi negara.
  • Untuk itu, kualiti kurikulumnya perlu dipertingkat dan disesuaikan dengan keperluan industri.
slide24

KerangkaKurikulumKolejVokasional

ON JOB TRAINING, AUTHENTIC ASSESSMENT

KLUSTER

PROGRAM KV

CONTOH-CONTOH

PROGRAM KV

MODUL AKADEMIK

CIVIL ENG TECH

ELECTRIC

ELECT & ELECTRONIC

ENG TECH

BAHASA MELAYU

ELECTRONIC

TELECOMUNICATION

BAHASA INGGERIS

MECH & MANUFACTURING

ENG TECH

MECHATRONIC

KV

BAHASA PERNIAGAAN

MANDARIN / ARAB / DLL

ICT

SEJARAH

BUSINESS

MODUL

TOURISM

GENERAL MATHEMATICS

HOSPITALITY

BAKERY & CONFECTIONARY

AGRICULTURE

SCIENCES

FASHION & DRESS MAKING

CHILD DEV & SERVICES

MARINE ENG. TECH

PEND. ISLAM / MORAL

CULINARY ARTS

ARTS & CULTURAL

SUPT SYS

COSMETOLOGY & WELLNESS

SCHOOL

ENTERPRISE

TRANSPORTATION

HEALTH SCIENCES

EQUINE

proses pembangunan kurikulum kv
Proses Pembangunan Kurikulum KV

Step 1

Mapping KV structural Program to NOSS

Lists of Job Profiles, Duties and Tasks

Cross Check with International Standard (eg. C & G, Edexcel etc.)

Step2

Categorized Duties and Tasks

According to Level of Certification

(embed with entrepreneurial and

employability skills)

Step 3

Propose title of Module of each Category Of Duties and Task

Step 4

Allocate Contact hour for Every

Module /Semester/ Year

pembentukan struktur kurikulum kv
PembentukanStrukturKurikulum KV
  • 6 – 11 modulvokasionalsetiaptahun (mencakupisetiap duties dan task mengikuttahap)
  • Penentuan jam kreditbagimoduladalahberdasarkankeperluan jam pertemuansetiaptahap
  • Jumlah Jam kreditbagisetiap semester maksimum 18-20 (termasukmodulakademik)
  • 1 Jam kredit = 1 jam kelasteori / 2 – 3 jam kelasamali
  • UntukmodulAkademik – tambahan 1 jam kelasAmali (dimanaperlu)
pembentukan struktur kurikulum kv1
PembentukanStrukturKurikulum KV
  • Struktur Ditetapkan
  • Keperluan Masa Pertemuan Modul Vokasional

(mengikiut keperluan NOSS)

slide29

CIRI UTAMA

KURIKULUM

CiriUtamaKurikulum Standard KV

Orientasipembelajaran

berasaskankerja

Kandungan pembelajaran

berasaskan kompetensi bekerja,

kompetensi Keusahawanan,

Kemahiran insaniah dengan

nisbah teori-amali ialah 30:70

Nisbahkomponenakademik

kepadavokasionalialah 30:70

slide30

CIRI UTAMA

KURIKULUM

CiriUtamaKurikulum Standard KV

Terbinadaripadaempatelemen – ilmu, aplikasi, kreativitidaninovasi

Merentasi tiga domain –

Jati diri (hearts-on),

Ketajaman minda

(Minds-on, hearts-on)

Kecekapan (hands-on)

Program pengajianbermodular

mengikutkluster yang memenuhi

keperluan NKEA danbernilai

kelarisantinggi

(high exchange value)

contoh jadual waktu kursus automotive technology semester 1
Contoh Jadual Waktu Kursus Automotive Technology – Semester 1

BilanganModuldan Jam Kredit

1 jam kredit = 1 jam kelasTeoriatau 2 - 3 jam kelasPraktikal

1jam Praktikaltidakdiambilkirasebagai jam kredit

slide32

Sistem Pengajian (Sistem Semester KV)

  • sistem penggal kepada sistem semester iaitu keseluruhan program pembelajaran mengambil masa empat tahun iaitu sebanyak lapan semester
  • Satu tahun pengajian dibahagikan kepada dua semester dan satu semester pendek.
  • Satu semester mengandungi 16 minggu manakala empat minggu dikhaskan untuk semester pendek
  • Semester pendek mengandungi latihan pratikal, entrepreneurship, pendidikan berasaskan produk (PBE), trainneeship dan modul-modul tertentu mengikut keperluan
  • Bermula pada jam 8.00 pagi dan berakhir pada jam 5.00 petang
  • Satu waktu pembelajaran adalah satu jam bukannya 30 hingga 40 minit seperti mana yang diamalkan di sistem sekolah harian
jadual semester
Jadual Semester

JumlahSesiPembelajaranadalah 18 minggu (termasukminggupeperiksaan)

18 x 2 sem = 36 minggu/tahun

keperluan semester pendek
Keperluan Semester Pendek
  • LatihanPraktikal (ulanganmodul/kompetensi yang tidakdicapaidalamtempohpengajian semester)
  • LatihanPraktikaluntukmempercepatkantempohpengajian (melengkapkanpengajiansehinggatahap 2 dalamtempoh 1 ½ tahun)
  • MelaksanakanaktivitiKeusahawanan (enterprising) – aktivititambahanpelajarsemasacuti – tambahan 4 jam kredit
  • LatihanPraktikalTambahan/OJT untukTahap 3 dan 4 (melengkapkeperluanmasapertemuansebanyak 1200 jam)
slide35

TempohPengajian

  • Mempunyai empat tahun pembelajaran iaitu tahun satu dan tahun dua merupakan Pra-Diploma manakala tahun tiga dan tahun empat adalah peringkat diploma
  • Pelajar mencapai CGPA sekurang-kurangnya 2.5 bagi melayakkan ke peringkat diploma
  • Manakala jenis program Latihan Kemahiran (SKM) pula mengandungi tempoh pengajian selama dua hingga tiga tahun
slide37

SistemPentaksiran

  • Sistem pentaksiran Kolej Vokasional telah bertukar dari kaedah konvensional kepada kaedah holistik
  • Kompenen pentaksiran merangkumi pentaksiran sekolah, pentaksiran pusat, peperiksaan pusat, pentaksiran aktiviti jasmani, sukan dan kokurikulum serta pentaksiran psikometrik.
  • Pentaksiran berterusan (PB) sebanyak 70 peratus manakala pentaksiran pusat sebanyak 30 peratus (amali dan bertulis)
  • Penyediaan instrumen penilaian dibuat oleh guru setiap proses P&P kerana pentaksiran pusat dibina oleh pusat berdasarkan Standard Kompetensi tetapi dirancang, ditadbir, diperiksa dan dilapor oleh guru.
slide38

PENTAKSIRAN BERASASKAN SEKOLAH (PBS)

  • PENTAKSIRAN BERTERUSAN (PB) (70 %)

- DOKUMEN GARISPANDUAN PENTAKSIRAN AKAN DIKELUARKAN OLEH LPM

- INSTRUMEN DISEDIA OLEH KV

  • PENTAKSIRAN PUSAT (30 %) (AMALI DAN BERTULIS)

- INSTRUMEN DISEDIA OLEH LPM

  • TIADA PEPERIKSAAN PUSAT
  • LP juga akan memuatnaik pentaksiran di dalam sistem supaya boleh diakses oleh pihak sekolah.
  • FORMAT PENTAKSIRAN MODUL AKADEMIK AKAN DIKELUARKAN OLEH LPM
slide40

PentaksiranModulAkademik

  • Projek Individu
  • Projek Kumpulan
  • Tugasan Amali
  • Perbentangan

SKILLS

Pentaksiran

Pusat

(PP)

10%

  • Kuiz
  • Ujian
  • Pentaksiran Kolej
  • Perbentangan

30%

KNOWLEDGE

PentaksiranBerterusan (PB)

70%

10%

30%

  • Kehadiran
  • Sahsiah
  • Grooming
  • Interpersonal
  • Intrapersonal

ATTITUDE

10%

slide41

PentaksiranModulVokasional

Pentaksiran

KerjaKursus

(PihakKolej)

  • Projek Individu
  • Projek Kumpulan
  • Tugasan Amali
  • Perbentangan

SKILLS

30%

PeperiksaanAkhir

(Berpusat LPM)

  • Kuiz
  • Ujian
  • Pentaksiran Kolej
  • Perbentangan

70%

KNOWLEDGE

30%

70%

  • Kehadiran
  • Sahsiah
  • Grooming
  • Interpersonal
  • Intrapersonal

ATTITUDE

30%

10%

slide42

NisbahKurikulumVokasional

  • Program KolejVokasionalmengandungi 70% kemahirandan 30% akademikmanakala program latihankemahiransebanyak 80% kemahirandan 20% akademik
  • KurikulumnyamerujukkepadaPiawaianKemahiranGunaTenagaKebangsaan (NOSS). SKM dan lain-lain bentukpersijilan yang diiktirafolehpihakindustri
slide43

Persijilan

  • TiadaSijilPeperiksaan Malaysia (SPM)
  • Pelajardiperolehi Diploma Vokasional Malaysia (DVM) dalamtempohempattahunpengajian
  • TahunSatudanTahunDuaperingkatPra-Diploma, TahunTigadanTahunEmpatperingkat diploma
  • Syaratmelanjutkanpengajiankeperingkat diploma pelajarperlumencapai CGPA 2.5 keatas.
  • Pelajar yang tidakmencapai CGPA 2.5 keatasdianugerahkan SKM tahapduadibawah JKM danbolehmelanjutkan SKM tahaptigadipusatlatihankemahiran
  • Manakala program latihankemahiranditawarkan SKM atauSijilAgensiLatihan Lain.
slide44

LatihanIndustri (On Job Training)

  • Semua pelajar perlu menghadiri “On Job Training” selama tiga bulan di mana-mana organisasi kerajaan, GLC, organisasi swatsa, badan NGO dan sebagainya
  • Semasa pelajar menghadiri latihan industri, pihak-pihak yang terlibat memberi tunjuk ajar kepada pelajar untuk membangunkan kemahiran dan pengetahuan para pelajar
  • Selain itu, latihan industri ini dapat memberi suasana atau persekitaran kerja yang sebenar kepada pelajar.
slide45

BahasaPengantar

  • Bahasamelayudan Bahasa Inggeris digunakan sebagai bahasa pengantar selain bahasa tambahan lain seperti bahasa Mandarin dan bahasa Arab
  • Sebagai persediaan untuk pelajar memenuhi pasaran pekerjaan antarabangsa
  • Penggunaan dan kemahiran bahasa Inggeris amat penting dalam era globalisasi.
slide46

TENAGA PENGAJAR KV

  • Pengajarakademiksamamacamtenagapengajarsekolah
  • Pengajarkemahirangunakantenagasediaada
  • Merekaperlumendapatkanbeberapasijilpengiktirafandaripadajpk
  • Sijil – sijilituialah
  • Sijilskmtahap 1 – 3
  • Sijil VTO, VTE, VTM
  • Sijil PPL
  • Sijilinduksi PPD
cabaran dihadapi kv
CABARAN DIHADAPI KV

SIKAP MASYARAKAT TERHADAP PENDIDIKAN KV

  • Pandangan KV adalahpendidikan second class
  • Menarikminatuntukmenyertai
  • Memberikankeyakinanpendidikankvmemberikanmanafaat
  • Memberi / mempamerkancontohkeluaran
  • Mengangkatmartabatbidang/kursus yang ditawarkan. Penjenamaan
slide48

MELAHIRKAN TENAGA MAHIR

  • Kurikulum yang terkinidanselarasdengankeperluanindustri
  • Penggunaanteknologisemasa
  • Sokonganmantapdariindustri.
  • Keyakinanindustriuntukmenerimapelajarkv
slide49

KUALITI TENAGA PENGAJAR DAN PUSAT LATIHAN

  • Tenagapengajar yang terampildanberpengalamandenganindustri
  • Kemahiranmenyediakanbahan P&P berdasarkanpembekalansemasa
  • Nisbahtenagapengajardenganbilanganpelajar
slide50

ISU SEMASA

  • PERUBAHAN SESUATU BERLAKU MENDADAK
  • WAKTU BEKERJA TIDAK SAMA DENGAN SEKOLAH BIASA, GRED GAJI SAMA DENGAN SEKOLAH – KURANG MOTIVASI
  • KEKURANGAN GURU MENGIKUT BIDANG. TETAPI BIDANG SITAWARKAN
  • PRASARANA YANG BELUM MANTAP
  • KETIDAK SERAGAMAN PENGAJARAN ANTARA KV