PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF - PowerPoint PPT Presentation

pembentang norman hisham anas redzuan bin shariff n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF PowerPoint Presentation
Download Presentation
PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF

play fullscreen
1 / 51
PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF
305 Views
Download Presentation
aquarius
Download Presentation

PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. KOLEJ VOKASIONAL KEMENTERIAN PENDIDIKAN MALAYSIA PEMBENTANG NORMAN HISHAM ANAS REDZUAN BIN SHARIFF

  2. PENDAHULUAN Aspirasi Program TransformasiKerajaandan Model BaruEkonomiberhasratuntukmerealisasikanrakyatnyamenjanaekonomiberpendapatantinggi. Modal insan yang berkeupayaanuntukberinovasidanmenerokabidang-bidangbaharudalamusahamenjanakekayaannegaraperludiwujudkan. PerdanaMenteri • BahagianPendidikanTeknikdanVokasional, telahdipertanggungjawabkanuntukmelaksanakantigaperkaraiaitu: • Meningkatkanenrolmendalampendidikanvokasional . • Merombakkurikulumpendidikanvokasionalsupayarelevandengankeperluanindustri. dan • Meningkatkankolaborasidenganpihakindustri.

  3. Kementerian Pelajaran Malaysia (KPM) menstruktur semula sistem pendidikan menerusi Transformasi Pendidikan Vokasional (TPV) adalah bertepatan bagi mengangkat martabat pendidikan vokasional sebagai aliran pendidikan yang akan menjadi pilihan pelajar • Transformasi pendidikan vokasional ini diperlukan untuk menyediakan tenaga kerja terlatih yang berkemahiran bagi memenuhi keperluan negara untuk memasuki pasaran pekerjaan. • Memartabatkan pendidikan vokasioanal ini akan mempercepatkan lagi usaha untuk menyediakan tenaga kerja yang kebolehan, berkemahiran dan berpendapatan tinggi bagi menjadikan Malaysia dapat merealisasikan sebagai sebuah negara maju dalam tahun 2020

  4. KolejVokasional Semua sekolah menengah vokasional di Malaysia akan bertukar kepada sistem Kolej Vokasional bermula pada tahun 2013. Kolej Vokasional bermula pada tahun 2013. • Sebagaijalanpintaskeperingkat diploma selepastingkatantiga • Menekankanamalanindustriatauamaliteknikaldanmengurangkankomposisiakademik • Kurikulumnya merujuk kepada Piawaian Kemahiran Guna Tenaga Kebangsaan (NOSS), SKM dan lain-lain bentuk pensijilan yang diiktiraf oleh pihak industri. • Kolej Vokasional menekankan “Soft Skills” supaya pelajar bukan hanya cemerlang di dalam kemahiran mereka malah gemilang di dalam faktor “persembahan diri” dan komunikasi.

  5. PERBANDINGAN PTV GLOBAL

  6. OBJEKTIF PENUBUHAN KOLEJ VOKASIONAL (KV) • Menghasilkanlepasanpendidikan KV yang memilikisijilkemahiranatau diploma yang diiktirafolehkerajaandanbadan-badanpensijilankebangsaan. • Menghasilkan 20 peratuslepasanpendidikan yang bersediamelanjutkanpengajianvokasionalkeperingkat yang lebihtinggi. • Menghasilkanlepasanpendidikan KV yang mempunyaitahapkebolehpekerjaan yang tinggi. Di sasarkanseramai 70 peratusdaripadagraduanakanmendapatpekerjaan di industri. • Menghasilkan 10 peratuslepasanpendidikan KV yang berupayamenjadiusahawan yang berdayasaing. • MemperkasakansistempenyampaianKementerianPelajaran Malaysia untukmelaksanakantransformasivokasional.

  7. HALA TUJU PENDIDIKAN VOKASIONAL Transformasikearah mencapai status negara maju.

  8. DUNIA PEKERJAAN INSTITUSI PENDIDIKAN TINGGI INSTITUSI PENDIDIKAN TINGGI VOKASIONAL DUNIA PEKERJAAN INSTITUSIVOKASIONAL POLITEKNIK & INSTITUSI TEKNIKAL SKM 4 SKM 3 SKM 2 SKM 1 Diploma Sijil LAIN-LAIN KEMENTERIAN ILKA Diploma Sijil KPM (AKTA PENDIDIKAN 1996) KOLEJ VOKASIONAL MATRIKULASI Bridging STPM SPM MENENGAH ATAS (2 TAHUN) 60% (2020) PMR MENENGAH RENDAH (3 TAHUN) PENDIDIKAN ASAS VOKASIONAL SKM 2 SKM 1 5% 95% UPSR PENDIDIKAN RENDAH (6 TAHUN)

  9. KONSEP KOLEJ VOKASIONAL KPM Period Duration Outcome Assessment Methodology Institution Stream/Field Voc : Academic Certification Industrial Training Medium of Instruction Other Languages

  10. BerikutadalahmerupakanKolejVokasional yang menjadiperintisdantelahdilaksanakanpadatahun 2012 1. KolejVokasionalArau 2. KolejVokasional Sungai Petani 1 3. KolejVokasionalBalikPulau 4. KolejVokasional Seri Manjung 5. KolejVokasional Shah Alam 6. KolejVokasional ERT Setapak 7. KolejVokasionalDato’ Lele Maharaja 8. KolejVokasionalDatukseriMohdZin 9. KolejVokasionalKluang 10. KolejVokasionalMuadzam Shah 11. KolejVokasional Kuala Terengganu 12. KolejVokasionalPengkalanChepa 13. KolejVokasional Kuching 14. KolejVokasional Beaufort 15. KolejVokasional Labuan

  11. BidangKursusKolejVokasional

  12. CADANGAN KURSUS KOLEJ VOKASIONAL

  13. Jenis Program Ditawarkan Di Kolej Vokasional Terdapattiga program yang ditawarkandi KV iaitu: a) Diploma Vokasional Malaysia (DVM) b) Program LatihanKemahiran (SKM) c) Program Apprenticeship atau Mode SLDN

  14. Diploma Vokasional Malaysia (DVM) • Program sepenuhmasaselamaempattahundanmenjalanitigabulan “On Job Training” diindustri • Satu tahun pengajian dibahagikan kepada dua semester dan satu semester pendek • Semester pendek mengandungi latihan pratikal, entrepreneurship, pendidikan berasaskan produk (PBE), trainneeship dan modul-modul tertentu mengikut keperluan • Tahunsatudantahunduadikenalisebagaipra-diploma manakalatahuntigadantahunempatadalahpringkat diploma • Komposisi pembelajaran yang merangkumi 30 peratus akademik dan 70 peratus kemahiran • Pelajardiperolehi Diploma Vokasional Malaysia (DVM) dalamtempohempattahunpengajian

  15. Program LatihanKemahiran (SKM) • Tempohpengajianadalahduatahunhinggatigatahun • Pelajar melaksanakan program SKM sepenuhnya di Kolej Vokasional dan menjalani tiga bulan “On Job Training” di industri • Komposisi pembelajaran yang merangkumi 20 peratus akademik dan 80 peratus kemahiran. • Menekankan pendidikan berasaskan produk (PBE), School Enterprise (SE) dan Competency-Based Education and Training (CBET). • Setelah tamat pengajian, pelajar dianugerahkan sijil kemahiran malaysia atau juga sijil agensi latihan lain

  16. Program Apprenticeship atau Mode SLDN • Temph pengajain Program Apprenticeship atau Mode Sistem Latihan Dual Nasional (SLDN) selama dua tahun • Pelajar akan belajar 30 peratus teori di Kolej Vokasional manakala 70 peratus amali dilaksanakan di industri • Memperolehi Sijil Pelajaran Aliran Kemahiran (SPAK) yang dikeluarkan oleh Lembaga Peperiksaan dan Sijil Kemahiran Malaysia (SKM) tahap 2 dan tahap 3

  17. SISTEM SEMESTER PROGRAM SIJIL & DIPLOMA KV NOTA : SISTEM FLEXIBEL YANG MEMBOLEHKAN PELAJAR MENAMATKAN PENGAJIAN DALAM TEMPOH 3 ½ TAHUN ATAU 4 TAHUN

  18. PEMBANGUNAN KURIKULUM KOLEJ VOKASIONAL • Transformasi pendidikan vokasional yang bermula pada tahun 2013 memberi penekanan kepada amalan industri atau amali teknikal dan akan mengurangkan komposisi akademik. • Kurikulumnya merujuk kepada Piawaian Kemahiran Guna Tenaga Kebangsaan (NOSS), SKM dan lain-lain bentuk pensijilan yang diiktiraf oleh pihak industri. • Pendidikan dan latihan vokasional sememangnya mempunyai peranan cukup penting dalam menyediakan laluan utama ke arah melahirkan modal insan yang berkemahiran tinggi seterusnya menyumbang kepada penjanaan kekayaan baru bagi negara. • Untuk itu, kualiti kurikulumnya perlu dipertingkat dan disesuaikan dengan keperluan industri.

  19. KerangkaKurikulumKolejVokasional ON JOB TRAINING, AUTHENTIC ASSESSMENT KLUSTER PROGRAM KV CONTOH-CONTOH PROGRAM KV MODUL AKADEMIK CIVIL ENG TECH ELECTRIC ELECT & ELECTRONIC ENG TECH BAHASA MELAYU ELECTRONIC TELECOMUNICATION BAHASA INGGERIS MECH & MANUFACTURING ENG TECH MECHATRONIC KV BAHASA PERNIAGAAN MANDARIN / ARAB / DLL ICT SEJARAH BUSINESS MODUL TOURISM GENERAL MATHEMATICS HOSPITALITY BAKERY & CONFECTIONARY AGRICULTURE SCIENCES FASHION & DRESS MAKING CHILD DEV & SERVICES MARINE ENG. TECH PEND. ISLAM / MORAL CULINARY ARTS ARTS & CULTURAL SUPT SYS COSMETOLOGY & WELLNESS SCHOOL ENTERPRISE TRANSPORTATION HEALTH SCIENCES EQUINE

  20. Proses Pembangunan Kurikulum KV Step 1 Mapping KV structural Program to NOSS Lists of Job Profiles, Duties and Tasks Cross Check with International Standard (eg. C & G, Edexcel etc.) Step2 Categorized Duties and Tasks According to Level of Certification (embed with entrepreneurial and employability skills) Step 3 Propose title of Module of each Category Of Duties and Task Step 4 Allocate Contact hour for Every Module /Semester/ Year

  21. Standard Kurikulum

  22. PembentukanStrukturKurikulum KV • 6 – 11 modulvokasionalsetiaptahun (mencakupisetiap duties dan task mengikuttahap) • Penentuan jam kreditbagimoduladalahberdasarkankeperluan jam pertemuansetiaptahap • Jumlah Jam kreditbagisetiap semester maksimum 18-20 (termasukmodulakademik) • 1 Jam kredit = 1 jam kelasteori / 2 – 3 jam kelasamali • UntukmodulAkademik – tambahan 1 jam kelasAmali (dimanaperlu)

  23. PembentukanStrukturKurikulum KV • Struktur Ditetapkan • Keperluan Masa Pertemuan Modul Vokasional (mengikiut keperluan NOSS)

  24. CIRI UTAMA KURIKULUM CiriUtamaKurikulum Standard KV Orientasipembelajaran berasaskankerja Kandungan pembelajaran berasaskan kompetensi bekerja, kompetensi Keusahawanan, Kemahiran insaniah dengan nisbah teori-amali ialah 30:70 Nisbahkomponenakademik kepadavokasionalialah 30:70

  25. CIRI UTAMA KURIKULUM CiriUtamaKurikulum Standard KV Terbinadaripadaempatelemen – ilmu, aplikasi, kreativitidaninovasi Merentasi tiga domain – Jati diri (hearts-on), Ketajaman minda (Minds-on, hearts-on) Kecekapan (hands-on) Program pengajianbermodular mengikutkluster yang memenuhi keperluan NKEA danbernilai kelarisantinggi (high exchange value)

  26. Contoh Jadual Waktu Kursus Automotive Technology – Semester 1 BilanganModuldan Jam Kredit 1 jam kredit = 1 jam kelasTeoriatau 2 - 3 jam kelasPraktikal 1jam Praktikaltidakdiambilkirasebagai jam kredit

  27. Sistem Pengajian (Sistem Semester KV) • sistem penggal kepada sistem semester iaitu keseluruhan program pembelajaran mengambil masa empat tahun iaitu sebanyak lapan semester • Satu tahun pengajian dibahagikan kepada dua semester dan satu semester pendek. • Satu semester mengandungi 16 minggu manakala empat minggu dikhaskan untuk semester pendek • Semester pendek mengandungi latihan pratikal, entrepreneurship, pendidikan berasaskan produk (PBE), trainneeship dan modul-modul tertentu mengikut keperluan • Bermula pada jam 8.00 pagi dan berakhir pada jam 5.00 petang • Satu waktu pembelajaran adalah satu jam bukannya 30 hingga 40 minit seperti mana yang diamalkan di sistem sekolah harian

  28. Jadual Semester JumlahSesiPembelajaranadalah 18 minggu (termasukminggupeperiksaan) 18 x 2 sem = 36 minggu/tahun

  29. Keperluan Semester Pendek • LatihanPraktikal (ulanganmodul/kompetensi yang tidakdicapaidalamtempohpengajian semester) • LatihanPraktikaluntukmempercepatkantempohpengajian (melengkapkanpengajiansehinggatahap 2 dalamtempoh 1 ½ tahun) • MelaksanakanaktivitiKeusahawanan (enterprising) – aktivititambahanpelajarsemasacuti – tambahan 4 jam kredit • LatihanPraktikalTambahan/OJT untukTahap 3 dan 4 (melengkapkeperluanmasapertemuansebanyak 1200 jam)

  30. TempohPengajian • Mempunyai empat tahun pembelajaran iaitu tahun satu dan tahun dua merupakan Pra-Diploma manakala tahun tiga dan tahun empat adalah peringkat diploma • Pelajar mencapai CGPA sekurang-kurangnya 2.5 bagi melayakkan ke peringkat diploma • Manakala jenis program Latihan Kemahiran (SKM) pula mengandungi tempoh pengajian selama dua hingga tiga tahun

  31. Catatan : 1 kelas 30 orang murid

  32. SistemPentaksiran • Sistem pentaksiran Kolej Vokasional telah bertukar dari kaedah konvensional kepada kaedah holistik • Kompenen pentaksiran merangkumi pentaksiran sekolah, pentaksiran pusat, peperiksaan pusat, pentaksiran aktiviti jasmani, sukan dan kokurikulum serta pentaksiran psikometrik. • Pentaksiran berterusan (PB) sebanyak 70 peratus manakala pentaksiran pusat sebanyak 30 peratus (amali dan bertulis) • Penyediaan instrumen penilaian dibuat oleh guru setiap proses P&P kerana pentaksiran pusat dibina oleh pusat berdasarkan Standard Kompetensi tetapi dirancang, ditadbir, diperiksa dan dilapor oleh guru.

  33. PENTAKSIRAN BERASASKAN SEKOLAH (PBS) • PENTAKSIRAN BERTERUSAN (PB) (70 %) - DOKUMEN GARISPANDUAN PENTAKSIRAN AKAN DIKELUARKAN OLEH LPM - INSTRUMEN DISEDIA OLEH KV • PENTAKSIRAN PUSAT (30 %) (AMALI DAN BERTULIS) - INSTRUMEN DISEDIA OLEH LPM • TIADA PEPERIKSAAN PUSAT • LP juga akan memuatnaik pentaksiran di dalam sistem supaya boleh diakses oleh pihak sekolah. • FORMAT PENTAKSIRAN MODUL AKADEMIK AKAN DIKELUARKAN OLEH LPM

  34. Pentaksiran

  35. PentaksiranModulAkademik • Projek Individu • Projek Kumpulan • Tugasan Amali • Perbentangan SKILLS Pentaksiran Pusat (PP) 10% • Kuiz • Ujian • Pentaksiran Kolej • Perbentangan 30% KNOWLEDGE PentaksiranBerterusan (PB) 70% 10% 30% • Kehadiran • Sahsiah • Grooming • Interpersonal • Intrapersonal ATTITUDE 10%

  36. PentaksiranModulVokasional Pentaksiran KerjaKursus (PihakKolej) • Projek Individu • Projek Kumpulan • Tugasan Amali • Perbentangan SKILLS 30% PeperiksaanAkhir (Berpusat LPM) • Kuiz • Ujian • Pentaksiran Kolej • Perbentangan 70% KNOWLEDGE 30% 70% • Kehadiran • Sahsiah • Grooming • Interpersonal • Intrapersonal ATTITUDE 30% 10%

  37. NisbahKurikulumVokasional • Program KolejVokasionalmengandungi 70% kemahirandan 30% akademikmanakala program latihankemahiransebanyak 80% kemahirandan 20% akademik • KurikulumnyamerujukkepadaPiawaianKemahiranGunaTenagaKebangsaan (NOSS). SKM dan lain-lain bentukpersijilan yang diiktirafolehpihakindustri

  38. Persijilan • TiadaSijilPeperiksaan Malaysia (SPM) • Pelajardiperolehi Diploma Vokasional Malaysia (DVM) dalamtempohempattahunpengajian • TahunSatudanTahunDuaperingkatPra-Diploma, TahunTigadanTahunEmpatperingkat diploma • Syaratmelanjutkanpengajiankeperingkat diploma pelajarperlumencapai CGPA 2.5 keatas. • Pelajar yang tidakmencapai CGPA 2.5 keatasdianugerahkan SKM tahapduadibawah JKM danbolehmelanjutkan SKM tahaptigadipusatlatihankemahiran • Manakala program latihankemahiranditawarkan SKM atauSijilAgensiLatihan Lain.

  39. LatihanIndustri (On Job Training) • Semua pelajar perlu menghadiri “On Job Training” selama tiga bulan di mana-mana organisasi kerajaan, GLC, organisasi swatsa, badan NGO dan sebagainya • Semasa pelajar menghadiri latihan industri, pihak-pihak yang terlibat memberi tunjuk ajar kepada pelajar untuk membangunkan kemahiran dan pengetahuan para pelajar • Selain itu, latihan industri ini dapat memberi suasana atau persekitaran kerja yang sebenar kepada pelajar.

  40. BahasaPengantar • Bahasamelayudan Bahasa Inggeris digunakan sebagai bahasa pengantar selain bahasa tambahan lain seperti bahasa Mandarin dan bahasa Arab • Sebagai persediaan untuk pelajar memenuhi pasaran pekerjaan antarabangsa • Penggunaan dan kemahiran bahasa Inggeris amat penting dalam era globalisasi.

  41. TENAGA PENGAJAR KV • Pengajarakademiksamamacamtenagapengajarsekolah • Pengajarkemahirangunakantenagasediaada • Merekaperlumendapatkanbeberapasijilpengiktirafandaripadajpk • Sijil – sijilituialah • Sijilskmtahap 1 – 3 • Sijil VTO, VTE, VTM • Sijil PPL • Sijilinduksi PPD

  42. CABARAN DIHADAPI KV SIKAP MASYARAKAT TERHADAP PENDIDIKAN KV • Pandangan KV adalahpendidikan second class • Menarikminatuntukmenyertai • Memberikankeyakinanpendidikankvmemberikanmanafaat • Memberi / mempamerkancontohkeluaran • Mengangkatmartabatbidang/kursus yang ditawarkan. Penjenamaan

  43. MELAHIRKAN TENAGA MAHIR • Kurikulum yang terkinidanselarasdengankeperluanindustri • Penggunaanteknologisemasa • Sokonganmantapdariindustri. • Keyakinanindustriuntukmenerimapelajarkv

  44. KUALITI TENAGA PENGAJAR DAN PUSAT LATIHAN • Tenagapengajar yang terampildanberpengalamandenganindustri • Kemahiranmenyediakanbahan P&P berdasarkanpembekalansemasa • Nisbahtenagapengajardenganbilanganpelajar

  45. ISU SEMASA • PERUBAHAN SESUATU BERLAKU MENDADAK • WAKTU BEKERJA TIDAK SAMA DENGAN SEKOLAH BIASA, GRED GAJI SAMA DENGAN SEKOLAH – KURANG MOTIVASI • KEKURANGAN GURU MENGIKUT BIDANG. TETAPI BIDANG SITAWARKAN • PRASARANA YANG BELUM MANTAP • KETIDAK SERAGAMAN PENGAJARAN ANTARA KV