slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
FEED ADDITIVES PowerPoint Presentation
Download Presentation

Loading in 2 Seconds...

play fullscreen
1 / 22

FEED ADDITIVES - PowerPoint PPT Presentation

  • Uploaded on


I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'FEED ADDITIVES' - amara

Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript


Departemen Peternakan Fak.Kedokteran Hewan UNAIR







Departemen Peternakan Fak.Kedokteran Hewan UNAIR




Suatubahanataukombinasibeberapabahan (biasanyakuantitasnyakecil) yang ditambahkan/dicampurkankedalamcampuranpakandasaruntukmemenuhikebutuhankhusus


  • Aman
  • Pemberiandalamjumlahtertentu

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

Feed additive dibagi 4 kategori:
  • a. Suplemen

Termasukdalamkategoriini: vitamin danprovitamin, asam amino, trace elemen, NPN

b. BahanPembantu:

  • Bahaniniessensialuntukternak
  • Untukmeningkatkankualitasdanpenggunaanbahanpakan meningkatkanproduksiternak
  • Antioksidan, enzim, probiotik, flavor, perekat pellet, pewarnadanpigmen

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

c. PerbaikanPencernaan
  • Preparatpemacupertumbuhan
  • Perbaikankonversipakan
  • Mengurangipengeluarannutriendalamekskreta

d. BahanPencegahPenyakit

  • Mencegahhewandariseranganpenyakit yang disebabkanolehparasit internal
  • Padaunggasbiasanyaberupakoksidiostat

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

  • Meningkatkanmetabolismetubuh menghasilkanpertumbuhan yang lebihbaik
  • Meningkatkankualitaspakan
  • Meningkatkanhasilproduksiternak


  • Pengikat Pellet
  • Bentonit
  • nilaigizikurang
  • Penggunaannya:
  • « 2,5% total ransum tidakmenimbulkankerugian


Departemen Peternakan Fak.Kedokteran Hewan UNAIR

2. ZatPemberibauharum
  • Tetes
  • meningkatkanpalatabilitasmeningkatkankonsumsi
  • Penggunaannya
  • « 5% total ransum untukunggas

< 40% total ransum untukruminansia

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

3. Mineral Zeolit « 4% total ransum
  • Merupakanbahantambang yang digunakanuntukmenambah mineral tertentu menjaga balance nutrient suaturansum
  • Dapatmengurangiamoniadalamkotoran
  • Dalamprosespencernaan non ruminansiaberperanmemperlambatlajupakan  memberipeluang yang besaruntukpenyerapanzat-zatnutrien

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

4. Antioksidan
  • MencegahKetengikanoksidatifdarilemakjenuhdalamransumdisebabkan kerusakan vitamin E, A & D  nilaibiologisdanenergiransummenurun
  • kerusakan
  • Perlupenambahandalamransum
  • Ethoxyquin
  • Vitamin E
  • BHT (Butylatedhydroxytoluen)

Kerusakan vitamin E, A & D


Departemen Peternakan Fak.Kedokteran Hewan UNAIR

5. Antibiotika


  • Meningkatkan penyerapan pakan
  • Meningkatkan daya cerna pakan
  • Meningkatkan efisiensi pakan
  • Meningkatkan pertumbuhan
  • Pencegahan penyakit  meningkatkan produksi dan keuntungan
  • Preparat yang sering digunakan: basitrasin, virginiamisin, spiramisin

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

6. Probiotik
  • Merupakankolonibakteri yang diberikanuntukternaktertentudengantujuantertentu
  • Tujuanuntukmeningkatkandayacerna, efisiensipakan, merangsangsintesis protein & mencernaseratkasar memacupertumbuhan/produksiternak

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

7. ObatTradisional:
  • DaunBeluntas
  • Mengandungstigmasterolsebagaiantibakteridanflavanoidberfungsisebagai anti virus
  • Mengandungasam amino essensial, lemak, karbohidrat, Ca, P, Fe, Vitamin A & C

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

  • Penambahandaunbeluntas 6% padaayampedagingdapatmeningkatkankecernaanbahankering (BK) danbahanorganik (BO)

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

b. Temulawak

- Pemberian± 2,5 %

  • Mengandungkurkumin (1,4 – 4%) danminyakatsiri (7,3- 29,5%)
  • Mempercepatpengosonganisilambung nafsumakanmeningkat

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

c. Kunyit (Curcuma domestica.val)
  • Untukmeningkatkanproduksi & kualitastelur
  • Dapatdigunakandalamkeadaansegar & hasilperasannyadicampurpakan

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

  • Minyakatsiri anti bakteriStap, Strep, Pseudomonas aerogenosa
  • Kurkumin anti bakteri
  • Desmetoksirkurkumin
  • Bisdesmetoksirkurkumin
  • Zatpahit
  • Lemak

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

Warnakuningtelurberubah-ubah/sesuaidenganpakan yang diberikan & sifatkhasindividuayam


- Pakan yang mengandung 46,7% jagungkuningwarnakuningtelurlebihgelapdaripadapakan yang mengandung 23,3% jagungkuning

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

Penambahan 1% tepungkunyitdalampakan: meningkatkanproduksitelur
  • Penambahan 2% tepungkunyitdalampakan: meningkatkanwarnakuningtelur mempunyaipotensisepertihijauan  klorofil & xantofil
  • Pemberianberlebihan: warnaputihtelurkekuningan & ekskretaberbaukunyit

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

8. DaunPepaya (Carica papaya)


  • enzimpapain proteolitik
  • Alkaloid
  • Karpaina
  • Glikosid
  • Saponin
  • Sakarosa
  • Dextrosa

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

Daunpepayamengandung vitamin A yang cukuptinggi, berfungsiuntukmeningkatkanwarnakuningtelur, warnakuningpadalemakdankulitunggas

Kandungan vitamin A: 18.250 IU ~ 10,95 mg β karoten yang berfungsisebagaiprovitamin A

Penambahansampai 2% tepungdaunpepayadapatmeningkatkanwarnakuningtelur

Departemen Peternakan Fak.Kedokteran Hewan UNAIR




Departemen Peternakan Fak.Kedokteran Hewan UNAIR