Download
erp enterprise resource planning n.
Skip this Video
Loading SlideShow in 5 Seconds..
ERP (Enterprise Resource Planning) PowerPoint Presentation
Download Presentation
ERP (Enterprise Resource Planning)

ERP (Enterprise Resource Planning)

140 Views Download Presentation
Download Presentation

ERP (Enterprise Resource Planning)

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. ERP (Enterprise Resource Planning) Pertemuan8 – evaluasidanpemeliharaan

  2. outline • Kesuksesanimplementasi • Evaluasidanpengukurankinerjasistem ERP • Evaluasifinansial • Evaluasiteknis • Pemeliharaansistem • Antisipasikegagalan

  3. Kesuksesanimplementasi

  4. User focus vs technology focus • user focus : implementasisistem ERP untukmendukungprosesbisnis user • Technology focus : implementasi ERP denganteknologiterbaruatauproses yang lebihkomplek, sehinggamemungkinkanterjadiperubahanprosesbisnis user • Sebaiknyasistem ERP fokuspadakebutuhan user, fokusteknologidapatdipertimbangkansetelahfokus user selesai

  5. Tata keloladanalokasiSDM • Implementasi ERP yang efektifmemerlukandukungandankomitmendaripimpinanmanajemen • Tim yang terlibatdalamimplementasi ERP harusorang yang berpengalamandibidangnyamasing-masingdanmemilikipengaruh • Tim yang ideal melibatkan user , spesialis TI diperusahaan, orang-orang yang dapatbekerjaantardepartemen, orang yang memahamiprosesbisnisdenganbaik

  6. Dukungan vendor dankonsultan • Idealnyaperusahaanmemilikikendaliutamaatasdukungan vendor danjasakonsultasi ERP • Penggunaankonsultansecaramenyeluruhperludihindari, karenaberartikonsultanakanmasukterlalujauhdalambisnisperusahaan

  7. pelatihan • Pelatihan yang burukmenjadisalahsatufaktorterbesargagalnyaimplementasi • Beberapakegagalan yang berhubungandenganpelatihan • Memberikanpelatihankaryawanpada software tertentutanpamemperhatikanprosesbisnisnya • Memusatkanperintahpadaurutaneksekusitanpamemberikanpenjelasankenapaadaurutantersebut • Menyingkatwaktupelatihan • Menyelesaikanmasalahdengancarasistem yang lama tanpamencaripenyelesaiandengancarasistem yang baru

  8. Beberapamasalah lain mencakup : keberagaman user, komplektifitassistem, keberagamanmetodepelatihan • Beberapa vendor mengantisipasihalinidenganmenyediakanpelatihan yang fleksibeldenganberbagaimacam media : • Web based virtual learning • Computer based training • Video course • Self study books • Pop up help screens

  9. Evaluasidanpengukurankonerja ERP

  10. evaluasikinerjadalamErpdibagi 2 • Evaluasikeuangan • Evaluasiteknis • Evaluasikeuanganfokuspadaidentifikasipenyimpanganantaraanggaran yang sudahditetapkandenganbiayaaktual yang dikueluarkan • Evaluasiteknisfokuspadakriteriateknismisalnya MIPS (million instructions per second) yang berhasildilaksanakan

  11. 1. Evaluasifinansial • Salahsatupendekatanyadenganmenggunakan balance score card (BSC) • Pendekatan BSC menekankanpada 4 perspektifatassuatu domain • Financial perspective • Customer perspective • Internal process perspective • Learning dan innovation perspective

  12. 1.a. perspektifkeuangan • Pertanyaan yang harusdijawab, seberapabesarbiayaimplementasi ERP • Secarakeuangansistem ERP masukinvestasikapital yang melibatkanpengeluarandanpemasukan • Permasalah yang munculdalamperspektifiniadalahbagaimanamengkonversikanasepkdalam ERP menjadiaspek yang bisadihitung (tangible) sehinggabisamasukbiayaataukeuntungan

  13. 1.b. perspektif customer • PertanyaanpadaperspektifiniadalahapakahErpdapatmendukungkebutuhanindividu user secaraefisien • Dalamperspektifini customer berarti • Penggunalangsung : karyawan • Penggunatidaklangsung : mitrakerja, supplier, subkon,dll

  14. Lanjutan…

  15. 1.c. perespektifproses internal • Pertanyaanpadaperspektifiniadalahsejauhmana ERP dapatmendukungprosesbisnis internal • Dibagiduakriteria • Proses yang diperlukanuntukmengoperasikansistem(sudutpandangoperasional) • Proses yang diperlukanuntukpeningkatandanperbaikankapasitassistem (sudutpandangpengembangan)

  16. Sudutpandangoperasional

  17. Sudutpandangpengembangan

  18. 1.d perspektifinovasidanpembelajaran

  19. 2. Evaluasiteknis • Ada 9 tahapan yang dapatdigunakanuntukmengukurkinerjasistem ERP • Mendefinisikankebutuhankinerjamisalnyawaktutanggap(response time) minimal yang dapatditerimauntukpenyelesaiantugassecarakeseluruhan(end to end) dankapasitasjaringanuntuksebuahantarmuka • Membangun program pengujiandengansemuakomponensudahterpasang • Mengatursemuainfrastruktursesuaikonfigurasi yang direkomendasikanoleh vendor

  20. Menjalankan unit test untuksetiapaplikasidalampaketmoduluntukmenjaminbahwasemuafungsi yang dibutuhkandapatberjalandenganbaik • Menjalankan integration test untukmenjaminkompabilitasdankonektifitasantaraseluruhkomponen • Menggunakanalat bantu monitoring untuksistem yang menjadi target berjalannya ERP misalsistemoperasi, basisdata, dan middleware • Mendefinisikanreferensidasarwaktutanggapuntuksemuatugasutamaketikasistemtidaksedangdalambebankerja yang berat

  21. Membangunsebuahreferensidasarwaktutanggap (response time) untuksemuatugasutamapadaberbagaikondisibebankerja • Jikakebutuhantidakberhasildipenuhi, lakukanperubahanpadaharware, software, danjaringankemudianulangipengujiantersebut

  22. Pemeliharaansistem

  23. Antisipasikegagalan

  24. Kegagalan ERP biasanyadisebabkanoleh : • Integrasisistem • Tidakadakesesuaianantarapersonil, prosesdanteknologi

  25. Peluangkegagalan yang perludiantisipasikan • Implementasikarenapeluangberpeluanggagaldaripada yang didasaribisnis • User kurangterlatih • Tidakmemahamibagaimanaaplikasi enterprise mengubahbisnisdantidaksiapmengikutidisiplinilmubaru • User belumsepenuhnyamenyadarisetiaptindakanmerekapadasistemberpengaruhpadaoperasionalperusahaan • Hasilpelatihan (training) yang kurangsesuaisehinggaterjadiketimpanganketika training danimplementasi

  26. Lebihlanjut… • Beberapa vendor sudahmenyediakanantisipasistrategiuntukmencapaitujuan ideal ERP (meningkatkanprosesintegrasi internal kekonektifitaseksternal) • Para vendor inimembuatproduknyalebihfleksibeldanlebihmudahdiimplementasikanmisal : • Strategiberbasiskomponen • ERP Berbasis web • ERP yang modular, yang bisadigunakan per modulnya