alden
Uploaded by
30 SLIDES
504 VIEWS
300LIKES

Functions and Separate Compilation

DESCRIPTION

Functions and Separate Compilation. Dr. Nancy Warter-Perez May 7, 2002. Outline. Discuss solution to homework 6 Introduction of workshop 11 Overview of File I/O - workshop 11.1 Switch statement - workshop 11.2 Functions - workshop 11.3 Separate compilation - workshop 11.4

1 / 30

Download Presentation

Functions and Separate Compilation

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Functions and Separate Compilation Dr. Nancy Warter-Perez May 7, 2002

  2. Outline • Discuss solution to homework 6 • Introduction of workshop 11 • Overview of • File I/O - workshop 11.1 • Switch statement - workshop 11.2 • Functions - workshop 11.3 • Separate compilation - workshop 11.4 • projects, header files, etc. • Homework 11 Bioinformatics Programming

  3. Homework 6 - Solution // This program will compute the %GC of a given sequence for a specified sliding window size. // Written By: Prof. Warter-Perez // Date Created: April 23, 2002 // Last Modified: // April 23, 2002 - Modified the program to write data to an output file. // April 24, 2002 - Modified the program to compute hydrophobicity using Kyte-Doolittle scale // May 7, 2002 - Modified the program to read sequence from an input file. The input and // output files are user defined. #include<stdlib.h> #include<string> #include<iostream> #include<fstream> using namespace std; Bioinformatics Programming

  4. Homework 6 - Solution int main () { string seq, file_in, file_out; float count; int i, j, window_size; float hydro[25] = {1.8, 0, 2.5, -3.5, -3.5, 2.8, -.04, -3.2, 4.5, 0, -3.9, 3.8, 1.9, -3.5, 0, -1.6, -3.5, -4.5, -0.8, -0.7, 0, 4.2, -0.9, 0, -1.3}; fstream fout, fin; Bioinformatics Programming

  5. Homework 6 - Solution cout << "This program will compute the hydrophobicity of a given sequence \nfor a specified sliding window size.\n" << endl; // Open the input file. cout << "Please enter the input filename:\t" << flush; cin >> file_in; fin.open(file_in.c_str(), ios::in); if(fin.fail()) { cout << "Error: input file does not exist. Program Terminating." << endl; return EXIT_FAILURE; } Bioinformatics Programming

  6. Homework 6 - Solution // Open the output file. cout << "Please enter the output filename:\t" << flush; cin >> file_out; fout.open(file_out.c_str(), ios::out); // Read in the sequence. fin >> seq; // Read in the window size. cout << "Enter the window size: "<< flush; cin >> window_size; Bioinformatics Programming

  7. Homework 6 - Solution // Compute the average hydrophobicity for specified window // size and write to output file. for (i = 0; i < seq.size() - window_size + 1; i++) { count = 0; for (j = i; j < i + window_size; j++) { count = count + hydro[toupper(seq.data()[j]) - 'A']; } fout << i << "\t" << count/window_size << endl; } return EXIT_SUCCESS; } Bioinformatics Programming

  8. Bacteriorhodopsin Sequence (short) The protein sequence in FASTA format: >gi|461612|sp|P33972|BACR_HALHS BACTERIORHODOPSIN (BR) LWLGTAGMFLGMLYFIARGWGETDGRRQKFYIATILITAIAFVNYLAMALGFGLTFIEFGGEQHPIYWAR YTDWLFTTPLLLYDLGLLAGADRNTIYSLVSLDVLMIGTGVVATLSAGSGVLSAGAERLVWWGISTAFLL VLLYFLFSSLSGRVANLPSDTRSTFKTLRNLVTVVWLVYPVWWLVGSEGLGLVGIGIETAGFMVIDLVA Bioinformatics Programming

  9. Window size = 14 Bioinformatics Programming

  10. Bacteriorhodopsin Sequence (long) • Bacteriorhodopsin precursor (BR) (number P02945) • www.ncbi.nlm.nih.gov/entrez • FASTA format • (Thanks to Edain Velazquez) • MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSAGDGAAATSD Bioinformatics Programming

  11. Hydrophobicity – Bacteriorodopsin (Window size = 10) Bioinformatics Programming

  12. Lecture 4 - Plot Bioinformatics Programming

  13. Workshop #11 • Workshop 11.1 Write a program to read in a PAM matrix into a 2-dimensional array. To test, print the 2-D array to stdout. Assume the 2-D array is a global array. • Workshop 11.2 Convert the program of 11.1 into a function without the prints to stdout. Test with dummy programs that display output to stdout. Bioinformatics Programming

  14. Workshop #11 • Workshop 11.3 Write a function that takes index I and index J and returns the PAM score for row I, column J. Assume the PAM matrix is a global array. • Workshop 11.4 Test each function separately and then combine into oneprogram that prompts the user for 2 amino-acids and returns their PAM score. Place the support functions developed in workshop 11.2 and 11.3 in a separate file than the main function. Use a header file to link them. Bioinformatics Programming

  15. File I/O (C++) • #include <fstream.h> • fstream fin, fout; // fin and fout are object names • fin.open(“infilename”, ios::in); // open a file to read • int x; fin >> x; // read an integer from input file into x • char c; fin >> c; // read a character from input file into x • string s; fin >> s; // read a string from input file into s • fout.open(“outfilename”, ios::out); • fout << x; // will write x into output file Bioinformatics Programming

  16. 2-D Arrays • int nums[2][3] = {{2,4,6},{-9,-7,-5}}; nums[0][0] == 2 nums[0][1] == 4 nums[0][2] == 6 nums[1][0] == -9 nums[1][1] == -7 nums[1][2] == -5 [0] [1] [2] 2 4 6 [0] [1] -9 -7 -5 Bioinformatics Programming

  17. Workshop #11 • Workshop 11.1 Write a function to read in a PAM matrix into a 2-dimensional array. • Have to parse the input to ignore file heading information and matrix column and row headings. Bioinformatics Programming

  18. Switch Statement int x, y; switch (x) { case 0: y = 1; break; case 1: y = 2; break; case 2: y = 3; default: y = 4; } x = 0? y = 1 x = 1? y = 2; x = 2? y = 4! Else y = 4 Bioinformatics Programming

  19. Switch Statement • Works with char and int char c; int y; switch (c) { case ‘a’: y = 1; break; case ‘b’: case ‘c’: y = 2; break; case ‘z’: y = 3; } Bioinformatics Programming

  20. 1-D Arrays as Look-Up Tables int table[3] = {1, 2, 2}; char c; if(c != ‘z’) y = table[c - ‘a’]; else y = 3; Bioinformatics Programming

  21. Functions • Break program into modules or functions • Easier to understand program • Functions can be reused (e.g.,library functions) • Easier to develop a program step by step • Can test each function independently • First function in a program must be “main” Bioinformatics Programming

  22. Functions <return_type> func_name (arg1_typ arg1_name, …, argN_typ argN_name) { function body } • Func_name – name of the function • main – all programs must start with this function • Return_type – type of value returned by function • Arguments • call-by-value – arguments are inputs to function that can’t be modified by function • Function prototype (used in header files [*.h]) <return_type> func_name (arg1_typ, …, argN_typ); • Library functions – commonly used functions • stdlib.h, stdio.h, math.h, string.h (to name a few) Bioinformatics Programming

  23. Workshop #11 • Workshop 11.2 Convert the programs of 11.1 into a function without the prints to stdout. Test with dummy programs that display output to stdout. Bioinformatics Programming

  24. Projects Separate Compilation Library functions *.a Compile File1.c (or .cpp) Link Executable *.exe … FileN.c (or .cpp) Compile Object files *.obj Bioinformatics Programming

  25. Separate Compilation • Break program into different files (can be developed by different people) • Arrange functions logically into files • Information is communicated between functions using header files • Projects contain all files that need to be compiled for a given executable Bioinformatics Programming

  26. Header Files • filex.cpp can export information to other files using a header file, filex.h • usually contains • function prototypes • constant declarations • global variables (extern) • user defined • #include “filex.h” // can specify the path if not // in same directory Bioinformatics Programming

  27. Header Files • filex.cpp #include <iostream.h> #include “filex.h” int call_x(int a) { cout << a << endl; return a++; } • filex.h int call_x(int a); • filey.cpp • #include <iostream.h> • #include “filex.h” • void main () { • int y; • y = call_x(5); • cout << y << endl; • } Bioinformatics Programming

  28. Workshop #11 • Workshop 11.3 Write a function that takes as input the PAM matrix, index I, and index J and returns the PAM score for row I, column J. • Workshop 11.4 Test each function and combine into oneprogram that prompts the user for 2 amino-acids and returns their PAM score. Place the support functions developed in workshop 11.2 and 11.3 in a separate file than the main function. Use a header file to link them. Bioinformatics Programming

  29. Homework #11 – due 5/14 • Write a function to determine the score of 2 sequences aligned by the Needleman-Wunsch method using the scoring method proposed in the Lecture 5. A gap in an aligned sequence will be represented by a period (“.”). • Test your function with a program that reads the sequences from standard input and displays the score to standard output. You should test your program with different sequences. • Modify your program to use PAM scoring rather than Match/Mismatch scores. Bioinformatics Programming

  30. Needleman-Wunsch Method The sequences abcdefghajklm abbdhijk are aligned and scored like this a b c d e f g h a j k l m | | | | | | a b b d . . . h i j k match 4 4 4 4 4 4 mismatch -3 -3 gap_open -2 gap_extend -1-1-1 for a total score of 24-6-2-3 = 13 Bioinformatics Programming

More Related