10 likes | 100 Views
Explore alignment of rat, mouse, and human SIRP proteins using ClustalW algorithm. Proline-rich regions and key residues highlighted. Study JAK2 binding.
E N D
raSIRPRIKQKKAKGSTSSTRLHEPEKNAREITQIQDTNDINDITYADLNLPKEKKPAPRVPEPNNHTEYASIETGKLPRPEDTLTYADLDMVHLNR--AQPTPKPEPSFSEYASVQVQRK 509 muSIRPRIKQKKAKGSTSSTRLHEPEKNAREITQIQDTNDINDITYADLNLPKEKKPAPRAPEPNNHTEYASIETGKVPRPEDTLTYADLDMVHLNR--AQPAPKPEPSFSEYASVQVQRK 509 huSIRP1 RIRQKKAQGSTSSTRLHEPEKNAREIT--QDT---NDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK 503 **:****:******************* *** ************ *****:..***********:*. * .**************** **:*************** ** Supplementary figure 3 Supplementary Figure 3. Alignment of the cytoplasmic SIRP protein sequences. Alignments were performed using the ClustalW algorithm (version 1.82) employing the following sequences: rat SHPS-1 (gi_6671640), mouse SHPS-1 (gi_1777354), and human SIRP1 (gi_2052056). The two proline-rich regions are overlined and the tyrosine and proline residues are highlighted in blue and red, respectively. The proline residues that, at least in case of the human SIRP1, are dispensable for JAK2 binding (42) are indicated by arrows.