1 / 1

Comparative Analysis of Cytoplasmic SIRP Protein Sequences

Explore alignment of rat, mouse, and human SIRP proteins using ClustalW algorithm. Proline-rich regions and key residues highlighted. Study JAK2 binding.

aaralyn
Download Presentation

Comparative Analysis of Cytoplasmic SIRP Protein Sequences

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. raSIRPRIKQKKAKGSTSSTRLHEPEKNAREITQIQDTNDINDITYADLNLPKEKKPAPRVPEPNNHTEYASIETGKLPRPEDTLTYADLDMVHLNR--AQPTPKPEPSFSEYASVQVQRK 509 muSIRPRIKQKKAKGSTSSTRLHEPEKNAREITQIQDTNDINDITYADLNLPKEKKPAPRAPEPNNHTEYASIETGKVPRPEDTLTYADLDMVHLNR--AQPAPKPEPSFSEYASVQVQRK 509 huSIRP1 RIRQKKAQGSTSSTRLHEPEKNAREIT--QDT---NDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK 503 **:****:******************* *** ************ *****:..***********:*. * .**************** **:*************** ** Supplementary figure 3 Supplementary Figure 3. Alignment of the cytoplasmic SIRP protein sequences. Alignments were performed using the ClustalW algorithm (version 1.82) employing the following sequences: rat SHPS-1 (gi_6671640), mouse SHPS-1 (gi_1777354), and human SIRP1 (gi_2052056). The two proline-rich regions are overlined and the tyrosine and proline residues are highlighted in blue and red, respectively. The proline residues that, at least in case of the human SIRP1, are dispensable for JAK2 binding (42) are indicated by arrows.

More Related