Internet untuk maba umm
Download
1 / 32

Internet untuk Maba UMM - PowerPoint PPT Presentation


  • 156 Views
  • Uploaded on

Internet untuk Maba UMM. Disampaikan pada TOT instruktur pelatihan aplikasi internet Maba UMM 11 Januari 2010 Muhammad Nasar , ST [email protected] Outline. PENGETAHUAN STANDAR tentang (5 hal): Layanan Hotspot di UMM Layanan E-mail di UMM Layanan Weblog (Blog) di UMM

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' Internet untuk Maba UMM' - zan


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Internet untuk maba umm

Internet untuk Maba UMM

Disampaikanpada TOT instrukturpelatihanaplikasi internet Maba UMM 11 Januari 2010

Muhammad Nasar, ST

[email protected]


Outline
Outline

PENGETAHUAN STANDAR tentang (5 hal):

  • Layanan Hotspot di UMM

  • Layanan E-mail di UMM

  • Layanan Weblog (Blog) di UMM

  • Forum Online di UMM

  • Pemanfaatan search engine


1 layanan hotspot di umm
1. Layanan Hotspot di UMM

  • TUJUAN

    • Mengenalkanfungsilayanan hotspot di UMM

  • DEFINISI DAN FUNGSI

    • HotSpotadalahsebuahwilayahterbatas yang dilayaniolehsatuataubeberapa Access Point Wireless LAN standar 802.11a/b/g. Di manapengguna (user) dapatmasukkedalam Access Point secarabebasdan mobile menggunakanperangkatsejenis notebook, laptop, PDA, dansebangsanya.

    • Hotspot di UMM berfungsi untuk mempermudah akses ke sumber informasi baik intranet maupun internet, dalam rangka menunjang kegiatan akademik


1 layanan hotspot di umm1
1. Layanan Hotspot di UMM

  • PROSEDUR DAN KEBIJAKAN UMUM

    • Terdaftarsebagaimahasiswa UMM (status aktif)

    • Telahmengisi PIC diPerpustakaan UMM

      • Membawa KTM dan KSM yang berlaku

      • Mengikutidiklatperpustakaan / mengisi PIC

    • Mengaktifkanwifipada laptop masing-masingdanmemilih SSID UMMHotspot

    • Setiapmahasiswamemiliki quota 5jam/hari

    • SetiapawalwaktusholatZuhur/Jumat, Ashar, Magribkoneksike internet dimatikansementarawaktu

    • UMM berhakmengambil/membaca log aksessetiapakun

    • Pengaduan / kritik / saran jikaadamasalah ?

      • LembagaInfokom – Divisijaringan (i-phone 178, email [email protected])

      • http://forum.umm.ac.id – Layanan Hotspot UMM



Langkah penggunaan
Langkah penggunaan

  • Pilih SSID UMMHotspot, pastikan sinyal > 1 bar


Langkah penggunaan1
Langkah penggunaan

  • Eksekusi browser dengan alamat tertentu, maka Anda akan diarahkan ke homescreen hotspot UMM

  • Pilih Login


Anjuran dan larangan
Anjuran dan larangan

  • Akses internet (non umm.ac.id) dianjur dilakukan sebelum jam 9 pagi atau setelah jam 14 siang, karena diantara itu adalah beban puncak traffic akses ke internet (koneksi lambat)

  • Dilarang menggunakan netcut, download accelerator, atau program/tools apapun yang dapat mengganggu kinerja jaringan/mengganggu pemakai lain


Beberapa istilah
Beberapa istilah

  • WiFi; singkatandariWireless Fidelity. Merupakansebuahteknologi yang memungkinkansejumlahkomputerterhubungdalamsuatujaringantanpakabel.

  • SSID; sengkatandariService Set Identifier; adalah 32 byte karakterunikuntukpenamaansinyal WLAN (Wireless LAN)

  • PIC; singkatandariPersonal Identification Code;Merupakankoderahasiapribadibagimahasiswa UMM untukmengaksesjaringan UMM. PIC awalnyadikembangkanpadasistempeminjamanbukudiPerpustakaan UMM.

  • Download; adalahprosespengambilansebuah file darijaringankekomputerlokal.


2 layanan e mail di umm
2. Layanan E-mail di UMM

  • TUJUAN

    • Mengenalkanfungsilayanan e-mail di UMM (http://webmail.umm.ac.id)

    • Mahasiswabisamengaktifkan email @webmail.umm.ac.id

  • DEFINISI DAN FUNGSI

    • E-mail, singkatandariElectronic Mail. Adalahpesanatausuratsecaraelektronik, baikberupateksmaupungabungandengangambar, yang dikirimkandarisatualamatkealamat lain dijaringaninternet.

    • Layanan e-mail di UMM dimaksudkanuntukmemfasilitasikebutuhanakses email bagiseluruhmahasiswa UMM sehinggatidakperlumenggunakanlayanan e-mail luar


Layanan e mail di umm
Layanan E-mail di UMM

  • PROSEDUR DAN KEBIJAKAN UMUM

    • Terdaftarsebagaimahasisswa UMM danmemiliki PIC

    • Alamataksesuntukmahasiswaadalah http://webmail.umm.ac.id

    • Setiapalamat email mahasiswa UMM menggunakan sub domain @webmail.umm.ac.id

    • E-mail dapatdiaksesdari intranet UMM maupundariluar UMM

    • Quota (space mailbox) 50Mb/mahasiswa, bisaditambahjikaperlu

    • Pengaduan / kritik / saran jikaadamasalah ?

      • LembagaInfokom – Divisijaringan (i-phone 178, [email protected])

      • http://forum.umm.ac.id – Layanan E-mail UMM




Pengetahuan pendukung
Pengetahuan pendukung

  • Domain (penyusunalamat) Internet terdiridari

    • Top level domain : com, net, mil, org, (negara, mis : id, jp, my, tw)

    • Sub domain tingkat 1 : ac.id, nasa.org, facebook.com

    • Sub domain tingkat 2 : umm.ac.id, itb.ac.id, jawapos.co.id, kompas.com

    • Lengkapnya : http://en.wikipedia.org/wiki/List_of_Internet_top-level_domains

  • Komponen email

    • To = kepada

    • Cc = Carbon copy (tembusan)

    • Bcc = Blind carbon copy (tembusantersembunyi)

    • Attachmnt = lampiran (berisi file tertentu)

    • Body message = isipesan / isisurat


Saran
Saran

  • Pahami Net Etiket (sopan santun ber-internet), yang terkait email antara lain

    • Tidak menggunakan huruf kapital semua

    • Tidak membahas SARA

  • Jangan memposting alamat email sembarangan di internet, karena akan mengundang SPAM

  • Jika terpaksa, maka upayakan alamat email ditulis dalam format gambar (gif,jpg,png) atau tulisan teks tidak terdefinisi mesin tapi masih terbaca manusia seperti nasar[at]umm.ac.id atau lebih ekstrim nasarATummDOTacDOTid


Beberapa istilah1
Beberapa istilah

  • Mailer : Program untukmenerima, membaca, menulisdanmengirim e-mail. Misalnya Outlook Express.

  • Mailbox : Suatulokasimemori yang menyimpan data yang berhubugandengansuratmenyurat.

  • Mailbomb: Kegiatanpengirimansejumlahbesar e-mail kesebuahalamat e-mail yang bermaksuduntukmemenuhi quota

  • Mailling list : Forum diskusimelalui email

  • Junk Mail : Email yang tidakterlaluberartibagipenerimanya. Misalnyapromosiproduk, ajakanuntukmengikuti multi level marketing, dlsb.

  • Spam : pesan yang tidakdiinginkan; pesansampah. Biasanyadikirimsecaraotomatisolehmesin/program/virus


3 layanan weblog blog di umm
3. Layanan Weblog (Blog) di UMM

  • TUJUAN

    • Mengenalkanfungsilayanan blog di UMM

    • Mahasiswamampumembuat blog di server http://student.umm.ac.id

  • DEFINISI DAN FUNGSI

    • Weblog (disinglat blog) adalahcatatanberkala yang dibuatolehseseorangatausekelompokorang yang dapatdiaksesmelalui web dandapatdikeloladenganmenggunakan (basis) web.

    • Tujuandisediakannya server blog http://student.umm.ac.idadalahuntukmenunjangbudayamenulisdan sharing pengetahuan (tertulis) bagimahasiswa UMM


3 layanan weblog blog di umm1
3. Layanan Weblog (Blog) di UMM

  • PROSEDUR DAN KEBIJAKAN UMUM

    • Server blog disediakanhanyabagimahasiswa UMM yang masihaktif

    • Memiliki PIC dan email @webmail.umm.ac.id

    • Quota 70 Mb/Mahasiswa

    • Setiapblogerharustetapmenjagasopansantundalammenulis, termasukmenghormatihakciptadenganmenyebutsumbernyajikaterdapatkarya/ tulisanorang lain yang dimuat

    • Setiap blogger wajibmembuatinlinkke Official Site UMM (http://www.umm.ac.id)

    • UMM berhakmemblokir blog yang bersifatmerugikaninstitusi / pihaktertentu




4 forum online di umm
4. Forum Online di UMM

  • TUJUAN

    • Mengenalkan forum online diUMM (http://forum.umm.ac.id)

    • Maba mengetahui cara registrasi dan cara berpartisipasi

  • DEFINISI DAN FUNGSI

    • Forum yang dimaksud adalah media interaksi online berbasis web yang disediakan UMM untuk memfasilitas berbagai keperluan kolaboratif di UMM


5 search engine
5. Search Engine

  • TUJUAN

    • Mengenalkanfungsi search engine dancontohnya

    • Mahasiswamampumenggunakanuntukpenelusuraninformasiakademik

  • DEFINISI SEARCH ENGINE

    • Search engine = mesinpencari, dimanasistem yang adapada search engine tersebutdiolahmelaluisatuatausekelompokkomputer yang berfungsiuntukmelakukanpencariandata. Data yang adapadamesininidikumpulkanmelaluimetodatertentu, dandiambildariseluruhserver yang dapatmerekaakses. Jikadilakukanpencarianmelalui search engine ini, makapencarian yang dilakukansebenarnyaadalahpadadatabase yang telahterkumpuldidalammesintersebut.

    • Contohmesinpencariiniadalah Google, Yahoo, Altavista, Livesearch, Exalead, SearchIndonesia, dll.


Tips trik optimasi hasil pencarian
Tips/trik optimasi hasil pencarian

  • 1. "Berpikir layaknya manusia".Saat memasukkan kata kunci (keyword) pada search engine jangan menggunakan kata-kata sinonim. Misalnya, jika Anda ingin menanyakan "dimana bisa saya dapatkan script film Titanic" kepada teman Anda, maka pada search engine cukup "movie script" AND Titanic. Bukannya Titanic movie film script book.


Tips trik optimasi hasil pencarian1
Tips/trik optimasi hasil pencarian

  • 2. Huruf KAPITAL.Secara umum selalu gunakan huruf kecil saat mengetikkan keyword di search engine, namun untuk beberapa search engine macam Altavista (www.altavista.com) huruf besar sangat berpengaruh. Pada Altavista jika Anda mengetikkan star maka hasil pencarian turut memasukkan website yang mengandung Star, STAR, staR dan lain lain. Tapi jika kata yang Anda masukkan adalah China maka hanya situs yang berhubungan dengan negara China saja yang akan ditampilkan


Tips trik optimasi hasil pencarian2
Tips/trik optimasi hasil pencarian

  • 3. Jangan Mendewakan Search Engine Tertentu.

    • Google (www.google.com), Yahoo (www.yahoo.com), adalah search engine yang sudah tak asing lagi bagi kita.

    • Namun untuk mencari situs lokal, Search Indonesia (www.searchindonesia.com) terkadang lebih baik daripada Google.


Tips trik optimasi hasil pencarian3
Tips/trik optimasi hasil pencarian

  • 4. Kehilangan Konsentrasi.

    • Kadang kita tergoda oleh informas-informas yang berada diluar konteks tujuan (misalnya dalam bentuk pop-up, iklan) sehingga melupakan tujuan awal browsing.

    • Tetaplah fokus pada informasi yang Anda cari.


Tips trik optimasi hasil pencarian4
Tips/trik optimasi hasil pencarian

  • 5. Gunakantanda “ “ untuksatufraseutuhTanda “ “ bertujuanuntukmembatasipencarian. JikaAndamengetikkan“apelbatu" makahanyasitus-situs yang mengandungtepatfraseApelBatuakanditampilkan.

  • 6. ManfaatkanDirektori

    • Untukhasilpencarian yang lebihtepat, beberapamesinpencarimenyediakanfasilitasdirektori yang akanmembawaandaketopik-topiktertentu yang sudahdiklasifikasikansedemikianrupauntukmemudahkanprosespencarian.

    • Mesinpencari yang menggunakandirektoriantara lain adalah Google, Yahoo, Lycos, danAltavista.


Tips trik optimasi hasil pencarian5
Tips/trik optimasi hasil pencarian

  • 7. Menggunakan tanda + dan -

    • Persempit wilayah pencarian dengan memanfaatkan ke dua tanda ini. Misalnya Anda ingin mencari tips bagaimana meng-uninstall paksa beberapa komponen Windows. Maka ketikkan +"Windows XP" +hint +tips +uninstall -sex -girl -"make money" pada search engine. Perhatikan susunan kata dari kiri ke kanan (hirarki yang semakin sempit). Tanda - bertujuan untuk membuang situs yang sama sekali tidak ada hubungannya dengan info yang sedang dicari. Tanda + dan - identik penggunaannya dengan operator boolean AND dan NOT


  • 8. Kombinasi Operator Boolean AND, OR dan NOT.

    • Contoh: woman AND cancer OR "breast cancer" NOT sex. Artinya search engine akan mencari situs yang berhubungan dengan wanita dan penyakit kanker payudara dan bukan situs-situs porno.


Contoh direktori pada search engine google
Contohdirektoripada search engine google


Penutup
Penutup

  • Pelatihan Aplinet Maba berfungsi sebagai GUIDE bagaimana menggunakan fasilitas IT di UMM bagi mahasiswa

  • Pelatih yang baik tentu saja yang mengetahui tentang yang dia ajarkan dan (telah) mengalaminya sendiri. Untuk itu berlatihlah dari sekarang !


ad