MANAJEMEN
This presentation is the property of its rightful owner.
Sponsored Links
1 / 33

MANAJEMEN MODAL KERJA PowerPoint PPT Presentation


  • 344 Views
  • Uploaded on
  • Presentation posted in: General

MANAJEMEN MODAL KERJA. MANAJEMEN MODAL KERJA. MODAL KERJA : INVESTASI ORGANISASI PADA BERBAGAI AKTIVA JANGKA PENDEK. PENTINGNYA : 1. SEBAGIAN BESAR PROPORSI WAKTU MANAJER KEUANGAN DIALOKASIKAN UNTUK MANAJEMEN MODAL KERJA

Download Presentation

MANAJEMEN MODAL KERJA

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Manajemen modal kerja

MANAJEMEN

MODAL KERJA


Manajemen modal kerja

MANAJEMEN MODAL KERJA

MODAL KERJA : INVESTASI ORGANISASI PADA BERBAGAI AKTIVA JANGKA PENDEK

  • PENTINGNYA :

  • 1. SEBAGIAN BESAR PROPORSI WAKTU MANAJER KEUANGAN DIALOKASIKAN UNTUK MANAJEMEN MODAL KERJA

  • LEBIH DARI 50% DARI TOTAL ASSET UMUMNYA DIINVESTASIKAN UNTUK MODAL KERJA

  • HUBUNGAN ANTARA PERTUMBUHAN PENJUALAN DAN KEBUTUHAN INVESTASI PADA AKTIVA LANCAR SANGAT ERAT DAN LANGSUNG

  • MANAJEMEN MODAL KERJA SANGAT PENTING BAGI PERUSAHAAN KECIL


Manajemen modal kerja

PEMENUHAN KEBUTUHAN MODAL KERJA

MODAL KERJA PERMANEN

MODAL KERJA VARIABEL

KENAIKAN PENJUALAN

PINJAMAN JANGKA PENDEK

PINJAMAN JANGKA PANJANG + MS

SUMBER PEMBIAYAAN

KEBIJAKAN PEMENUHAN

KONSERVATIF

MODERAT

AGRESIF


Manajemen modal kerja

KEBIJAKAN PEMENUHAN MODAL KERJA

  • PT “CDR” sedang mempelajari untuk menetukan tingkat aktiva lancar yang optimal untuk tahun depan. Manajemen memperkirakan penjualan akan meningkat sebesar Rp 1 Milyar. Perusahaan mempertahankan rasio utang 50%. Nilai aktiva tetap saat ini sebesar Rp 400 juta. Tingkat bunga pinjaman rata-rata 12%. Manajer keuangan menginginkan untuk menganalisis 3 alternatif :

  • Kebijakan Konservatif dengan aktiva lancar sebesar 60% dari penjualan

  • Kebijakan Moderat dengan mempertahankan tingkat aktiva lancar 50% dari penjualan

  • Kebijakan Agresif dengan tingkat aktiva lancar sebesar 40% dari penjualan.

  • Diasumsikan : tingkat EBIT sebesar 10% dari penjualan dan tarif pajak 25%.

  • 1. Kebijakan mana yang paling baik

  • 2. Bagaimana komentar saudara terhadap keputusan atas kebijakan tersebut


Manajemen modal kerja

MANAJEMEN KAS

MOTIF : TRANSAKSI (TRANSACTION MOTIVE)

BERJAGA JAGA (PRECAUSIONARY MOTIVE)

SPEKULASI (SPECULATIVE MOTIVE)

MANFAAT : MEMBERIKAN KEMUNGKINAN POTONGAN PENJUALAN

TERM OF CREDIT 2/10 NET 60

DAPAT MEMPENGARUHI CURRENT RATIO


Manajemen modal kerja

Anggaran Kas

  • Suatuperusahaansedangmerencanakanuntukmenyusun Budget Kasuntuk semester I tahun 2014. Data-data yang tersediasbb.:

  • Rencanapenjualan :

  • JanRp 240.000AprilRp 250.000

  • PebrRp 245.000MeiRp 255.000

  • MaretRp 246.000JuniRp 260.000

  • Dari rencanapenjualantersebut 20% dijualsecaratunai, sisanyadengankreditdenganpolapenerimaansbb. 50% diterima 1 bulansetelahbulanpenjualan, sisanyaduabulansetelahbulanpenjualan. Data penjulanbln Nov dan Des 2013 masing-masingsebesarRp 230.000 danRp 236.000

  • Pembelianbahanbaku per bulansbb.:

  • Jan Rp 120.000aPRILRp 130.000

  • PebrRp 120.000 MeiRp 135.000

  • mARETRp 130.000 JuniRp 130.000

  • Pembayaranupah :

  • Jan Rp 50.000 AprilRp 50.000

  • PebrRp 50.000MeiRp 60.000

  • MaretRp 60.000JuniRp 55.000


Manajemen modal kerja

  • 4.Pembayaranbiaya-biayalainnya :

  • JanRp 55.000AprilRp 70.000

  • PebrRp 65.000MeiRp 65.000

  • MaretRp 70.000JuniRp 60.000

  • 5.Pembayaranpajak :

  • Mei sebesarRp 20.000

  • Berdasarkan data tersebut,

  • Menyusun Budget Kasuntuk semester I tahun 2014

  • SaldoKas per 31 des 2013 diperkirakanRp20.000. SaldoKas minimum sebesarRp6.000.

  • 2.Jikaterjadidefisitkasdiupayakanmeminjamdari bank, danjikaterjadi surplus diupayakanuntukmengangsurpinjaman.


Manajemen modal kerja

ANGGARAN KAS SEMESTER I : 2008


Manajemen modal kerja

BUDGET PENGUMPULAN PIUTANG


Manajemen modal kerja

MANAJEMEN PIUTANG

  • FAKTOR-FAKTOR YANG MEMPENGARUHI PIUTANG :

  • VOLUME PENJUALAN KREDIT

  • PERIODE PENGUMPULAN PIUTANG

  • KEBIJAKAN KREDIT

EVALUASI PEMBERIAN KREDIT : 5 “C” ATAU 3 “R”

  • EVALUASI PERUBAHAN KEBIJAKAN KREDIT :

  • MODEL SARTORIS-HILL :

    INTERLATIONSHIP ANTARA KEBIJAKAN KREDIT, PRODUKSI, PENJUALAN DAN PENGARUHNYA TERHADAP TIMING DAN KUALITAS ALIRAN KAS


Manajemen modal kerja

MENCARI NPV TERTINGGI OPERASI HARIAN,

FORMULA DASAR :

P = HARGA PER UNIT

C = COST PER UNIT

Q = PENJUALAN HARIAN

b = TINGKAT KERUGIAN BAD DEBT

t = PERIODE PENGUMPULAN

k = TINGKAT BUNGA HARIAN


Manajemen modal kerja

Perusahaan mempertimbangkan untuk merubah kebijakan kredit . Saat ini perusahaan dapat menjual 100 unit produk setiap hari dengan harga Rp 10.000/unit. Harga pokok/unit sebesar Rp 8.500.

Kebijakan kredit saat ini:

Term of credit : 2/10 n. 40

30% langganan memanfaatkan potongan tersebut, sedangkan sisanya tidak memanfaatkan potongan tunai dengan rata-rata bad debt (piutang tak tertagih sebesar 2%.

Kebijakan kredit yang direncanakan :

Term of Credit : 2/10 n. 60. Kelongaraan jangka waktu kredit direncanakn karena harga BBM meningkat sehingga harga pokok/unit meningkat menjadi Rp 9.000. Harga jual juga meningkat menjadi Rp 11.000/unit.

Penjualan diharapkan meningkat menjadi 120 unit setiap hari, namun pelanggan yang memanfaatkan potongan tunai akan turun menjadi 20% . Bad debt juga akan meningkat menjadi 4%. Jika biaya modal sebesar 12%.

Apakah perubahan kebijakan kredit tersebut perlu dilakukan ?


Manajemen modal kerja

PENGEMBANGAN FORMULA

KEPUTUSAN :

NPV1 > NPV0  KEBIJAKAN BARU DAPAT DILAKSANAKAN


Manajemen modal kerja

Perusahaan mempertimbangkanuntukmerubahkebijakankredit . Saatiniperusahaandapatmenjual 100 unit produksetiapharidenganhargaRp 10.000/unit. Hargapokok/unit sebesarRp 8.500.

Kebijakankreditsaatini:

Term of credit : 2/10 n. 40

30% langgananmemanfaatkanpotongantersebut, sedangkansisanyatidakmemanfaatkanpotongantunaidengan rata-rata bad debt (piutangtaktertagihsebesar 2%.

Kebijakankredit yang direncanakan :

Term of Credit : 3/10 n. 40. Kelonggaranjangkawaktukreditdirencanaknkarenaharga BBM meningkatsehinggahargapokok/unit meningkatmenjadiRp 9.000. HargajualjugameningkatmenjadiRp 11.000/unit.

Penjualandiharapkanmeningkatmenjadi 110 unit setiaphari, namunpelanggan yang memanfaatkanpotongantunaiakannaikmenjadi 40% . Bad debt tetapsebesar 2%. Jikabiaya modal sebesar 12%.

Apakahperubahankebijakankredittersebutperludilakukan ?


Manajemen modal kerja

PENGEMBANGAN FORMULA

KEPUTUSAN :

NPV1 > NPV0  KEBIJAKAN BARU DAPAT DILAKSANAKAN


Manajemen modal kerja

MANAJEMEN PERSEDIAAN

BAHAN BAKU (RAW MATERIAL)

JENIS PERSEDIAAN

BARANG DALAM PROSES (WIP)

BARANG JADI (FINISHED GOODS)


Manajemen modal kerja

ANALISIS PERSEDIAAN

  • BAGAIMANA MENYEIMBANGKAN INFLOW DAN OUTFLOW KEBUTUHAN

  • MENENTUKAN BESARNYA SAFETY STOCK

  • PENGADAAN OPTIMAL (EOQ)

  • PERBEDAAN SKALA INVESTASI PADA PERSEDIAAN AKAN MENGAKIBATKAN BEBERAPA BIAYA NAIK SEDANG YANG LAIN AKAN TURUN


Manajemen modal kerja

JENIS BIAYA DALAM PERSEDIAAN


Manajemen modal kerja

KARAKTERISTIK BIAYA PERSEDIAAN

Biaya (Rp)

BIAYA TOTAL

BIAYA SIMPAN

BIAYA PESAN

0

Persediaan (Q)


Manajemen modal kerja

EOQ (ECONOMICAL ORDER QUANTITY)

EOQ = KUANTITAS PEMESANAN YANG PALING EKONOMIS

R= KEBUTUHAN (PENGGUNAAN) BAHAN TAHUNAN

S= BIAYA PEMESANAN SEKALI PESAN

P= HARGA / UNIT BAHAN

I= % BIAYA SIMPAN


Manajemen modal kerja

EOQ (ECONOMICAL ORDER QUANTITY)

CONTOH :

Kebutuhantahunan= 100.000 unit

Biayapemesanansekalipesan= Rp 3.500

BiayaSimpan = 20% dari rata-rata persediaan

Harga / unit bahanbaku= Rp 1.000

Total Cost = Biayapesan + BiayaSimpan

= = …….. + ……..

= 374.165


Manajemen modal kerja

EOQ (ECONOMICAL ORDER QUANTITY)

Berapa Total Biaya, jikabesarnya Q = 2.000 unit

Total Cost = Biayapesan + BiayaSimpan

= = …….. + ……..

= ………..


Manajemen modal kerja

EOQ (ECONOMICAL ORDER QUANTITY)

CONTOH :

Kebutuhantahunan= 1.000.000 unit

Biayapemesanansekalipesan= Rp 3.500

BiayaSimpan = 25% dari rata-rata persediaan

Harga / unit bahanbaku= Rp 1.000

Total Cost = Biayapesan + BiayaSimpan

= = 661.375.66 + 661.500

= 1.322.875.66


Manajemen modal kerja

EOQ (ECONOMICAL ORDER QUANTITY)

Total Cost = Biayapesan + BiayaSimpan

= = 661.375.66 + 661.500

= 1.322.875.66


Manajemen modal kerja

EOQ (ECONOMICAL ORDER QUANTITY)

REORDER POINT = SAFETY STOCK + PEMAKAIAN SELAMA LEAD TIME

JIKA : SAFETY STOCK = 1.000 UNIT

LEAD TIME = 2 MINGGU

MAKA :

REORDER POINT = 1.000 +(100.000/360 X 14)


Manajemen modal kerja

EXERCISE

Perhitunganbiayaproduksidariperush X per 31 Desember 2010 sbb.:

Raw Material per 1 Jan 2010 = 3.000 unitRp 3.000.000

Pembelianselamasetahun =10.000 unitRp 10.000.000

Rp 13.000.000

Raw Material Inventory pada 31 Desember 2010Rp 1.000.000

Raw Material yang digunakandalamprosesproduksiRp 12.000.000

Direct LaborRp 10.000.000

Overhead PabrikRp 8.000.000

Total biayapabrik yang dibebankanRp 30.000.000

Work in process per 1 Januari 2010Rp 5.000.000

Rp 35.000.000

Work in Process per 31 Desember 2010Rp 15.000.000

Cost of Goods ManufacturedRp 20.000.000

Finished Goods per 1 Januari 2010Rp 20.000.000

Rp 40.000.000

Finished Goods per 31 Desember 2010Rp 10.000.000

Cost of Goods SoldRp 30.000.000


Manajemen modal kerja

  • Data lain yang diperlukan :

  • Procurement Cost setiap kali pesanansebesarRp 200.000

  • Carrying cost Raw Material Inventory sebesar 30%

  • Seandainyarencanaproduksidan forecasting pembiayaanuntuktahun 2010 persissamasepertitahun 2009, sdrdiminta :

  • Menghitung EOQ

  • Total Biaya Inventory untuktahun 2010

  • Seandainyamulai 1 Januari 2010 perusahaanmulaimengadakan safety stock Raw Material sebesar 500 unit danuntukmemperoleh Raw Matreialbarudibutuhkan Lead Time selama 2 minggu, makagambarkangrafikpersamaan Raw Material untukperusahaantersebutdenganmenunjukkanwaktu Reorder Point yang tepat.


Manajemen modal kerja

KARAKTERISTIK BIAYA PERSEDIAAN

Biaya (Rp)

BIAYA TOTAL

BIAYA SIMPAN

BIAYA PESAN

0

500

1000

1500

2000

2500

3000

Persediaan (Q)


Manajemen modal kerja

SELESAI


  • Login