1 / 27

Muhammad Sapta Murti Deputi Bidang Perundang-undangan Kementerian Sekretariat Negara R.I. - PowerPoint PPT Presentation

  • Uploaded on

Permasalahan dalam hamonisasi secara vertikal peraturan daerah dengan peraturan perundang-undangan di INDONESIA. Muhammad Sapta Murti Deputi Bidang Perundang-undangan Kementerian Sekretariat Negara R.I. DASAR HUKUM. UUD 1945;

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about ' Muhammad Sapta Murti Deputi Bidang Perundang-undangan Kementerian Sekretariat Negara R.I. ' - whitby

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

Permasalahandalamhamonisasisecaravertikalperaturandaerahdenganperaturanperundang-undangandi INDONESIA

Muhammad SaptaMurti


KementerianSekretariat Negara R.I.

Dasar hukum

  • UUD 1945;

  • Undang-Undang Nomor 10 Tahun 2004 tentang Penyusunan Peraturan Perundang-undangan;

  • Undang-Undang Nomor 32 Tahun 2004 tentang Pemerintahan Daerah.


  • HarmonisasiVertikal: upayauntukmenyelaraskan, menyerasikan, menyeimbangkan, menyesuaikan, danmengonsistensikanseluruhelemen yang terdapatdalamperaturandaerah yang sedangdisusundenganperaturanperundang-undangan yang lebihtinggiterutamadalamlingkuppengaturan yang sama/sejenis, denganmempertimbangkannilai-nilai yang dianutolehmasyarakatsetempatdansesuaidengankebutuhanmasyarakattersebut.

  • PeraturanPerundang-undangan: peraturantertulis yang dibentukolehlembaganegaraataupejabat yang berwenangdanmengikatsecaraumum.

    (Pasal 1 angka 2 UU Nomor 10 Tahun 2004)

  • Peraturan Daerah: peraturanperundang-undangan yang dibentukolehdewanperwakilanrakyatdaerahdenganpersetujuanbersamakepaladaerah.

    (Pasal 1 angka 7 UU Nomor 10 Tahun 2004)

Hierarki peraturan perundang undangan di indonesia

  • UUD 1945;

  • Undang-Undang/Peraturan Pemerintah Pengganti Undang-Undang;

  • Peraturan Pemerintah;

  • Peraturan Presiden;

  • Peraturan Daerah.

    [Pasal 7 ayat (1) UU Nomor 10 Tahun 2004 ]

1. Pasal 27 UU No. 10 Tahun 2004

Ketentuan lebih lanjut mengenai tata cara mempersiapkan rancangan peraturan daerah yang berasal dari gubernur atau bupati/walikota diatur dengan Peraturan Presiden

2. Urusan pemerintahan yang menjadi urusan pemerintah pusat yaitu: politik luar negeri, pertahanan, keamanan, yustisi, moneter dan fiskal, dan agama (Pasal 10 ayat 3 UU no. 32 tahun 2004)

Tinjauan singkat peraturan daerah

  • Pemerintahandaerahsebagailembaga yang merepresentasikanotonomidaerahberwenanguntukmembentukPeraturan Daerah dalamrangkapelaksanaanotonomididaerahnya.

  • DasarhukumpembentukanPeraturan Daerah adalahsebagaiberikut:

  • Pasal 18 ayat (6) UUD 1945 menyatakanbahwapemerintahandaerahberwenanguntukmenetapkanperaturandaerahdanperaturan-peraturan lain untukmelaksanakanotonomidantugaspembantuan.

  • Pasal 1 angka 7 UU Nomor 10 Tahun 2004 menetapkanbahwa yang dimaksuddenganperaturandaerahadalahperaturanperundang-undangan yang dibentukolehdewanperwakilanrakyatdaerahdenganpersetujuanbersamakepaladaerah.

  • UU Nomor 32 Tahun 2004 tentangPemerintahandaerah, antara lain Pasal 1 angka 2 menyatakanbahwapenyelenggaraanurusanpemerintahanolehpemerintahdaerahdan DPRD menurutasasotonomidantugaspembantuandenganprinsipotonomiseluas-luasnyadalamsistemdanprinsip Negara KesatuanRepublik Indonesia sebagaimanadimaksuddalamUndang-UndangDasar Negara Republik Indonesia Tahun 1945.

Tinjauan singkat peraturan daerah lanjutan 1

  • MaterimuatanPeraturan Daerah berdasarkanPasal 12 UU Nomor 10 Tahun 2004 meliputiseluruhmateri yang berkaitandenganpelaksanaanotonomidaerahdantugaspembantuan, sertauntukmenampungkondisikhusus (khas) daerahotonom, danuntukmelaksanakanlebihlanjutperaturanperundang-undanganditingkat yang lebihtinggi.

  • Pasal 2 UU Nomor 32 Tahun 2004 menetapkanbahwa:

  • NKRI dibagiatasdaerah-daerahprovinsi yang dibagaiataskabupatendankota yang masing-masingpemerintahandaerah yang mengaturdanmengurussendiriurusanpemerintahanmenurutasasotonomidantugaspembantuan;

  • Pemerintahandaerahdimaksudmenjalankanotonomiseluas-luasnya, kecualiurusanpemerintahan yang menjadiurusanPemerintah, dengantujuanmeningkatkankesejahteraanmasyarakat, pelayananumum, dandayasaingdaerah;

Tinjauan singkat peraturan daerah lanjutan 2

  • PemerintahandaerahdalammenyelenggarakanurusanpemerintahanmemilikihubungandenganPemerintahdandenganpemerintahandaerahlainnya yang meliputihubunganwewenang, keuangan, pelayananumum, pemanfaatansumberdayaalam, dansumberdayalainnya yang dilaksanakansecaraadildanselarasdanmenimbulkanhubunganadministrasidankewilayahanantarsusunanpemerintahan.

  • Negara mengakuidanmenghormatisatuan-satuanpemerintahandaerah yang bersifatkhususataubersifatistimewa yang diaturdenganundangundang, sertamengakuidanmenghormatikesatuan-kesatuanmasyarakathukumadatbesertahaktradisionalnyasepanjangmasihhidupdansesuaidenganperkembanganmasyarakatdanprinsip Negara KesatuanRepublik Indonesia.

Tinjauan singkat peraturan daerah lanjutan 3

  • PadadasarnyaasasdesentralisasimenurutUndang-UndangNomor 32 Tahun 2004 memberikanataumenyerahkansebagianurusanpemerintahan yang menjadi domain kewenanganPemerintahkepadadaerahotonom.

  • Bentukotonomidaerahadalahberupaurusandanwewenangpemerintahan yang diberikanolehPemerintahkepadadaerahotonomuntukmengaturdanmegurusmasyarakatdaerahnya, dalamkerangkamelaksanakanotonomidaerahdantugaspembantuanditingkatpemerintahanlokal. Dalamhalinitidakadaurusandankewenanganlegislatifmaupunyudikatif yang diserahkankepada Daerah Otonom.

Tinjauan singkat peraturan daerah lanjutan 4

  • Perubahanparadigmapenyerahanurusandankewenanganberdasarkanasasdesentralisasidantugaspembantuanbertujuanuntukmewujudkantatapemerintahandaerah yang baik. Pelaksanaanhalinitercermindalamhakdaerahotonomuntukmengaturseluruhurusan yang terkaitdengantugas, kewajiban, dantanggungjawab yang meliputihakuntukmenyelenggarakanurusanpemerintahandaerah, keamanandanketertibandaerah, pengelolaansumberdayaalamuntukmeningkatkankesejahteraanmasyarakatnya, sertauntukmenyediakandanmemperbaikipelayananumum.

  • PembentukanPeraturan Daerah merupakansalahsatumanifestasikewenangandaerahdalammenyelenggarakanotonomidaerahdandanmengaturmasyarakatnya.

Lembaga pembentuk peraturan daerah

Peraturan Daerah meliputi:

  • Peraturan Daerah Provinsi dibentukolehdewanperwakilanrakyatdaerahprovinsibersamadenganGubernur;

  • Peraturan Daerah Kabupaten/Kota dibentukolehdewanperwakilanrakyatdaerahkabupaten/kotabersamadenganBupati/Walikota;

  • PeraturanDesa/Peraturan yang setingkat  dibentukolehbadanperwakilandesaataunamalainnyabersamadenganKepalaDesa.

    [Pasal 7 ayat (2) UU Nomor 10 Tahun 2004]

Fungsi peraturan daerah

  • Sebagaiinstrumenkebijakanuntukmelaksanakanotonomidaerahdantugaspembantuan; dalamhaliniperaturandaerahharustundukdantidakbolehbertentangandenganperaturanperundang-undangan yang lebihtinggikarenaperaturandaerahmerupakanperaturanpelaksanaandariperaturanperundang-undangan yang lebihtinggitersebut;

  • Sebagaiinstrumen yang menampungkekhususandankeragamandaerah, sertauntukmenyampaikanaspirasimasyarakatsetempat;

  • Sebagaiinstrumenpembangunandalamrangkameningkatkankesejejahteraanmasyarakatdidaerahotonom.

Urgensi harmonisasi vertikal peraturan daerah

  • Harmonisasiperaturanperundang-undanganadalahproses yang ditujukanuntukmemastikankesesuaiandankeselarasandiantaraperaturanperundang-undangan, agar tidakmenimbulkantumpangtindih, ketidakkonsistenan, konflikataupertentangandidalampengaturannya. Harmonisasidiberlakukanterhadapseluruhperaturanperundang-undanganbaiksecaravertikalmaupun horizontal.

  • HarmonisasiVertikalmemegangperananpentingdalamprosespembentukanperaturandaerah. Hal inimerupakantidakterlepasdariposisiperaturandaerahdalamhierarkiperaturanperundang-undangan Indonesia danfungsinyasebagaiinstrumenuntukmelaksanakanotonomidaerah.

Urgensi harmonisasi vertikal peraturan daerah lanjutan 1

  • Harmonisasimemerlukanketelitian, kecermatan, danketepatanterutamadalammengidentifikasiperaturanperundang-undangan lain yang terkait, menganalisisapakahnorma yang diaturbersesuaianataubertentangan, dankemampuanuntukmenentukanpilihanpolitikhukumapabilaterjadi/ditemukanpertentangandanketidaksesuaianantararancanganperaturanperundang-undangandenganperaturan yang telahada.

  • Pasal 18 UU Nomor 10 Tahun 2004 junctoPeraturanPresidenNomor 68 Tahun 2005 menetapkanbahwaterhadapperaturanperundang-undanganperludilakukanpengharmonisasian. Selaindidasarkanatasketentuantersebut, berikutadalahpertimbangan lain yang mendasariperlunyaharmonisasi :

Urgensi harmonisasi vertikal peraturan daerah lanjutan 2

  • Peraturanperundang-undanganmerupakanbagian yang menyatudengansistemhukumnasional.

    Peraturanperundang-undangansebagaisistematausubsistemdarisistem yang lebihbesardalamketatanegaraanhendaknyamemilikikarakterdanfiturtertentudimanasalahsatunyaadalahketerhubungandanketergantungandiantaraketentuan yang diaturdanmerupakanelemen yang diintegrasikansecarakomprehensifdidalamsistemhukum.

Urgensi harmonisasi vertikal peraturan daerah lanjutan 3

  • Peraturanperundang-undangan yang lebihrendahtidakbolehbertentangandenganperaturan yang lebihtinggi (apabilaterjadipertentangan/perbedaan , peraturanperundang-undangan yang lebihtinggiberlaku);

  • Harmonisasiperaturanperundang-undangandiperlukanuntukmempertahankankeselarasan, konsistensi, keserasian, kelengkapan, dankeutuhan/kebulatanperaturanperundang-undangansebagaibagiandarisistemhukum agar dapatberfungsisecaratepatdanefektif;

  • Terhadapperaturanperundang-undangandapatdilakukanujimateriilolehMahkamahKonstitusidanMahkamahAgungsesuaihirerarkinya. UntukPeraturan Daerah yang dianggapbermasalahdanbertentangandenganperaturanperundang-undangan yang lebihtinggidapatdilakukan “executive review”. Mengingathaldemikian, makaharmonisasimenjaditahap yang paling tepatuntukmeminimalisasikonflikataupertentanganantaraPeraturan Daerah denganperaturanperundang-undangan lain yang lebihtinggi, yang berakibatpadapembatalanataupencabutanPeraturan Daerah yang bermasalah;

  • Untukmemastikanbahwapembentukanperaturanperundang-undangandilaksanakansesuaidenganasaspembentukanperaturanpembentukannyasehinggamampumenciptakankepastianhukum.

Identifikasi masalah

  • Daerah menganggapdengantidakadanyakerangkaacuan yang jelasdalammembentukPeraturan Daerah makapembentukanPeraturan Daerah mengabaikanketentuan-ketentuanprinsipmengenaiasasdanmaterimuatanpembentukanPeraturan Daerah sebagaimanaditetapkandalam UU Nomor 10 Tahun 2004 dan UU Nomor 32 Tahun 2004;

  • Daerah memahamiprinsip-prinsippengaturanpenyusunanPerdasesuai UU Nomor 10 Tahun 2004 dan UU Nomor 32 Tahun 2004 namunkurangkapasitaspengetahuandanpengalamandalammelakukanteknik-teknikperumusannorma yang dinilaitidakbertentangandenganperaturanperundang-undangan;

  • KurangnyapemahamandikalanganpenyusunPeraturan Daerah mengenaiteknikpenyusunanPeraturan Daerah yang antara lain disebabkanolehkurangnyapengalamanpenyusunPeraturan Daerah mengenaiilmupengetahuanperundang-undangandanteknikpenyusunanPeraturan Daerah sesuaiketentuanperaturanperundang-undangan;

  • Langkah-langkahpembinaan yang dilakukanolehinstansiPusatkepadaaparaturpemerintahdaerahdalampenyusunanPerdakemungkinanbelum optimal danbelummerata;

Identifikasi masalah lanjutan 1

  • Belumadanyakerangkaacuan yang jelasbagidaerahmengenaitatalaksanaharmonisasiRancanganPeraturan Daerah sebagaisalahsatuinstrumenpentingdalamrangkamenjagaharmonisasiPeraturan Daerah denganperaturanperundang-undangan lain terutama yang lebihtinggi. PeraturanPresiden yang mengaturtentang Tata Cara MempersiapkanPeraturan Daerah hinggakinibelumditetapkan;

  • Bentuk-bentukhubungankomunikasi, konsultasi, klarifikasiRancanganPeraturan Daerah antarainstansiPemerintahdenganaparatterkaitdidaerah yang selamainiditerapkankemungkinankurangefektif;

  • PeranGubernurdalammembinadanmengawasipenyelenggaraanpemerintahankabupatan/kotakemungkinanbelum optimal;

Identifikasi masalah lanjutan 2

  • Peraturanperundang-undangan yang menjadilandasanataupedomanPeraturan Daerah dalammenyusunPeraturan Daerah mengalamiperubahanataupergantian yang cepatdandaerahkurangsiapmenyikapiperubahantersebut;

  • Peraturanperundang-undanganmenjadilandasanataupedomanbagidaerahdalammenyusunanPeraturan Daerah terlambatditerbitkan;

  • Secarateknis, lingkupperaturanperundang-undangan yang harusdiharmonisasiolehdaerahbanyakdanberagammulaidari UU sampaidenganPeraturanMenteri, sehinggaprosesharmonisasiRancanganPeraturan Daerah membutuhkanwaktudanenergi yang lebihbanyak;

  • Ketidakkonsistenanperaturanperundang-undanganditingkatPusatdapatberdampakterjadinyakekeliruandaerahdalammenentukanketentuanacuanhukum. Hal inibisajugaterjadidalamhalterdapatperaturanpelaksanaan yang dipandangtidaksesuaidengandengan UU pokoknya;

Identifikasi masalah lanjutan 3

  • Kurangnyasosialiasiperaturanperundang-undanganmenimbulkanperbedaanpersepsidanpemahamanantaraaparaturdaerahdenganinstansiPemerintah;

  • KetidaksiapanPemerintahdalammenyediakanketentuanmengenainorma, standar, prosedur, dankriteriapelaksanaansuatuurusanpemerintahantertentudapatmendorongdaerahmengambilinisiatif-inisitafsendiridenganmembuatperaturanataukebijakan yang dapatbertentangandengan PP;

  • Pendelegasianpengaturansuatuhaltertentudalamperaturanperundang-undangankepadaPeraturan Daerah yang tidakjelasterutamalingkupmaterimuatan yang diperintahkanuntukdiaturPeraturan Daerah, dapatmempersulitdaerahdalammenyusunPeraturan Daerah. Pendelegasianpengaturankepadaperaturandaerah yang tidakspesifikmenyebuttingkatanPeraturan Daerah dapatberpotensimenimbulkanperselisihankewenangandantumpangtindihpengaturan;

  • KoordinasiantarainstansiPemerintahdalammelakukanpembinaandanpengawasanterhadapPeraturan Daerah kemungkinanbelumsinergisdanterpadu.

Data mengenai peraturan daerah bermasalah

  • KementerianDalamNegerimencatatsepanjangkurunwaktu 2002 hingga 2009 telahada 1878 Peratudandaerah yang dibatalkan.

  • SampaidenganbulanJuli 2009 terdapat 1152 Peraturan Daerah mengenaipajakdanretribusidaerah yang telahdibatalkan. Sebelumberlakunya UU Nomor 32 Tahun 2004 sudahterdapatsekitar 8000 Peraturan Daerah tentangpajakdanretribusidaerah yang dibuatdanlebihdari 3000 Peraturan Daerah tersebutterindikasibermasalah.

Data mengenai peraturan daerah bermasalah lanjutan 1

  • SementaraituKementerianKeuanganmenginformasikandarihasilevaluasiterhadapPeraturan Daerah yang mengaturtentangPajak Daerah danRetribusi Daerah sejak 2001 hingga 14 Agustus 2009 menunjukkan, dari total 9.714 Peraturan Daerah, terdapat 3.455 Peraturan Daerah yang direkomendasikandibatalkanataudirevisi. Dari sisijenisusaha, Peraturan Daerah yang bermasalah paling banyakditerbitkandisektorperhubungan, industridanperdagangan, pertanian, budayadanpariwisata, sertakehutanan. Terdapat 2.566 rancanganPeraturan Daerah tentangPajak Daerah danRetribusi Daerah dan 1.727 dariRancanganPeraturan Daerah tersebut yang direkomendasikanuntukditolakataudirevisi. RancanganPeraturan Daerah bermasalahinimasihdisektorperhubungan, industridanperdagangan, pekerjaanumum, budayadanpariwisata, sertakesehatan.

  • KementerianKeuanganjugamendatasampaidengan 31 Maret 2009, Peraturan Daerah bermasalah paling banyakterdaptdisektortransportasi (447 Peraturan Daerah), disusulindustridanperdagangan (387 PeraturanDerah), pertanian (344 Peraturan Daerah) dankehutanan (299 Peraturan Daerah).

Data mengenai peraturan daerah bermasalah lanjutan 2

  • MenurutKementerian Negara Koperasidan UKM, terdapat 26 dari 92 peraturandaerah yang bertentangandenganpemberdayaankoperasi, usahamikro, kecildanmenengah (KUMKM), dan yang  terkaitdenganpajakdanretribusidaerahtelahdibatalkanolehKementerianDalamNegeri;

  • Masihterdapat 340 Peraturan Daerah yang bertentangandenganpemberdayaan KUMKM sesuai UU Nomor 28 Tahun 2009 tentangPajakdanRetribusi Daerah. Dari 340 Perdatersebutsejumlah 234 peraturandaerahtelahdiusulkanpembatalannyakepadaKementerianDalamNegeri, sebanyak 63 diantaranyatelahdisetujuipembatalannya, dan 171 PeraturanDeaerahlainnyamasihdalamprosespertimbangandiKementerianDalamNegeridanKementerianKeuangan. Sementaraitu, KementerianDalamNegerijugatelahmenyampaikansebanyak 706 Peraturan Daerah bermasalahkepada BPK untukdiawasi.

Data mengenai peraturan daerah bermasalah lanjutan 3

  • Menurut Kementerian Dalam Negeri pada tahun 2010 terdapat 3000 Peraturan Daerah yang diklarifikasi dan 407 diantaranya bermasalah.

  • Pada tahun 2011 in iakan diklarifikasi 9000 Peraturan Daerah dan hingga 4500 Peraturan Daereah yang telah diklarifikasi dan 175 Peraturan Daerah dinyatakan bermasalah.


  • HarmonisasiterhadapRancanganPeraturan Daerah harusdidukungdenganperaturanperundang-undangan yang jelasdantegas agar persyaratanformildanmateriilpembentukannyadipenuhi;

  • Peninjauankembalidanoptimalisasi program legislasidaerah;

  • Harmonisasiperaturanperundang-undanganditingkatpusatdapatditerapkandalamharmonisasiPeraturan Daerah denganpenyesuaian-penyesuaian yang diperlukandenganberlandaskanpadaPasal 18 ayat (3) Undang-UdnangNomor 10 Tahun 2004. PeraturanPresidenmerupakaninstrumenhukum yang paling tepatuntukmengaturmengenaimekanismeatautatacarapembentukanPeraturan Daerah, termasukpengharmonisasiannyabaiksecaravertikalmaupun horizontal.

Solusi lanjutan 1
SOLUSI lanjutan-1

  • Komunikasi yang efektifdenganpemerintahandaerahdanpemangkukepentingandidaerahtelahdimulaisejaktahapperencanaandanpersiapanpembentukanPeraturan Daerah untukmeminimisasipotensikonflik;

  • Aksesterhadappartisipasimasyarakat yang lebihterbuka, luasdanbertanggungjawab;

  • PeningkatankemampuandankompetensipenyusunPeraturan Daerah perludilakukandenganmekanismependidikandanpelatihan yang sistematikdanberkala;

  • Penyempurnaandanperbaikansistempembinaan, supervisi, danpemantauanantaraPemerintahterhadapPemerintah Daerah dan internal Pemerintah Daerah.
