Zat aditif btp btm
Download
1 / 32

ZAT ADITIF/BTP/BTM - PowerPoint PPT Presentation


  • 313 Views
  • Uploaded on

ZAT ADITIF/BTP/BTM. Agus Suyanto http://tekpan.unimus.ac.id. definisi :. Zat yang ditambahkan, dan dicampur pada waktu pengolahan makanan baik itu disengaja ataupun tidak disengaja. Mengapa BTP Sering Ditambahkan ke Dalam Pangan?. Mengawetkan pangan Membentuk pangan Memberikan warna

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' ZAT ADITIF/BTP/BTM ' - tamarr


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Zat aditif btp btm

ZAT ADITIF/BTP/BTM

Agus Suyanto

http://tekpan.unimus.ac.id


Definisi
definisi:

Zat yang ditambahkan, dan dicampur pada waktu pengolahan makanan baik itu disengaja ataupun tidak disengaja


Mengapa btp sering ditambahkan ke dalam pangan
Mengapa BTP Sering Ditambahkan ke Dalam Pangan?

  • Mengawetkan pangan

  • Membentuk pangan

  • Memberikan warna

  • Meningkatkan kualitas pangan

  • Menghemat biaya

  • Memperbaiki tekstur

  • Meningkatkan cita rasa

  • Meningkatkan stabilitas


  • Penyimpangan/ pelangaran penggunaan BTM oleh produsen :

    • Menggunakan bahan tambahan yg dilarang utk makanan

    • Menggunakan BTM melebihi batas yg diijinkan

  • Persyaratan BTM

    • Telah diuji dan dievaluasi secara toksikologi

    • Tdk membahayakan kesehatan konsumen pd kadar yg diperlukan dlm penggunaannya

    • Hrs dipantau terus menerus dan dievaluasi kembali jika perlu, sesuai perkembangan teknologi dan hasil evaluasi toksikologi

    • Hrs memenuhi persyaratan spesifikasi dan kemurnian yg tlh ditetapkan

    • Hrs dibatasi penggunaannya


  • Penggunaan BTM hanyadibenarkanutktujuan :

    • Mempertahankannilaigizimakanan

    • Konsumsisegolongan orang tertentuygmemerlukandiit

    • Mempertahankanmutu/kestabilanmakanan/ memperbaikisifatorganoleptiknyahinggatdkmenyimpangdarisifatalamiahnya

    • Keperluanpembuatan, pengolahan, penyediaan, perlakuan, pewadahan, pembungkusan, pemindahan, pengangkutanmakanan

  • Tidakdiperbolehkanutk :

    • Menyembunyikancarapembuatan/ pengolahanygtidakbaik

    • Mengelabuhikonsumen (memberikesanbaikpadahaldibuatdrbahanygkurangbaikmutunya)

    • Menurunkannilaigizimakanan


Penggunaan BTM

  • Dosisnya dibawah ambang batas yang telah ditentukan.

  • Jenis BTP ada 2 :

    1. GRAS (Generally Recognized as Safe)

    → aman dan tidak berefek toksin (cth : glukosa).

    2. ADI (Acceptable Daily Intake)

    → harus ditetapkan batas penggunaan hariannya (daily intake).

  • SK Menteri Kesehatan RI No.722/MenKes/Per/IX/88 → mengenai bahan tambahan pangan


Golongan BTM yang diijinkan

  • Golongan BTM yang diijinkan oleh Menkes RI No.722/MenKes/Per/IX/88, antara lain:

  • 1. Antioksidan (Antioxidant)

  • 2. Antikempal (Anticaking Agent)

  • 3. Pengatur Keasaman (Acidity Regulator)

  • 4. Pemanis Buatan (Artificial Sweetener)

  • 5. Pemutih dan pematang telur (Flour Treatment Agent)

  • 6. Pengemulsi, Pemantap, dan Pengental (Emulsifier, Stabilizer, Thickener)

  • 7. Pengawet (Preservative)

  • 8. Pengeras (Firming Agent)

  • 9. Pewarna (Colour)

  • 10. Penyedap Rasa dan Aroma, Penguat Rasa (Flavour, Flavour Enhancer)

  • 11. Sekuestran (Sequestrant)


Golongan BTM yang dilarang

  • Bahan Tambahan yang dilarang menurut Permenkes RI No. 722/Menkes/Per/IX/88, sebagai berikut:

    • Natrium Tetraborat (Boraks)

    • Formalin (Formaldehyd)

    • Minyak nabati yang dibrominasi (Brominanted Vegetable Oils)

    • Kloramfenikol (Chlorampenicol)

    • Kalium Klorat (Pottasium Chlorate)

    • Dietilpirokarbonat (Diethylpyrocarbonate, DEPC)

    • Nitrofuranzon (Nitrofuranzone)

    • P-Phenetilkarbamida

    • Asam Salisilat dan garamnya

  • Bahan tambahan lain yang dilarang, antara lain rhodamin B (pewarna merah), methanyl yellow (pewarna kuning), dulsin (pemanis sintetis), dan kalsium bromat (pengeras)


  • Penggolongkan btp tidak tercantum dalam permenkes
    Penggolongkan BTPTidak tercantum dalam Permenkes

    • Enzim

    • Penambah Gizi

    • Humektan


    Pengelompokan zat aditif berdasarkan asalnya
    PengelompokanZataditifberdasarkanasalnya :

    • Zat aditif alami : berasal dari sumber alami

    • Zat aditif sintetik : berasal dari bahan-bahan kimia (buatan pabrik)


    Pewarna

    • Memberi kesan menarik bagi konsumen

    • Menyeragamkan warna makanan

    • Menstabilkan warna

    • Menutupi perubahan warna selama proses pengolahan

    • Mengatasi perubahan warna selama penyimpanan


    Pewarna alami
    PEWARNA ALAMI

    • KuningKunyit

    • Hijau Daunsuji

    • Coklat  Buahcoklat

    • Merahcoklat  daunjati

    • Kuning-merah  wortel

      Kelebihan : amandikonsumsi,

      menghasilkan aroma yang enakdan

      khasselainwarnanya.

      Kekurangan : pilihanwarnanyaterbatas

      danwarnanyatidaktajamsepertipewarna

      Sintetis, tidakpraktis.



    Banyak sekali faktor yang menentukan kualitas produk akhir.

    Tidak hanya rasa dan aroma atau nilai nutrisinya akan tetapi kenampakan yang banyak dipengaruhi oleh warna ikut berperan.

    Umumnya zat warna alam terdapat dalam plastida yang terdapat dalam plasma sel.



    Klorofil
    KLOROFIL yang menyebabkan kerusakan jaringan perlu dihindarkan sedapat mungkin.

    • Klorofil merupakan pigmen hijau yang terdapat dalam kloroplas bersama-sama dengan karoten dan xantofil.

    • Di dalam ini terdapat bermacam-macam klorofil misalnya a, b, c dan d, bakteriofil a dan b dan klorobium klorofil, akan tetapi yang paling umum berperan dalam pangan hanya klorofil a dan b.


    • Dalam daun klorofil banyak terdapat bersama-sama dengan protein dan lemak yang bergabung satu dengan yang lain.

    • Dengan lipid, klorofil berikatan melalui gugus fitol-nya sedangkan dengan protein melalui gugus hidrofobik dari cincin porifin-nya.

    • Rumus empiris klorofil adalah C55H72O5N4Mg (klorofil a) dan C55H70O6N4Mg (klorofil b)


    • Klorofil yang berwarna hijau tersebut tidak stabil dan dapat mudah berubah menjadi coklat bila berhubungan dengan asam sebab atom Mg akan diganti dengan atom H sehingga terbentuk senyawa yang disebut Feofitin.

    • Apabila klorofil kehilangan gugus fitol-nya akan menjadi klorofilid yaitu senyawa yang berwarna merah terang larut dalam air tetapi lebih stabil dibandingkan klorofil.


    Flavonoid
    Flavonoid mudah berubah menjadi coklat bila berhubungan dengan asam sebab atom Mg akan diganti dengan atom H sehingga terbentuk senyawa yang disebut Feofitin.

    • Flavonoid adalah zat warna alam yang mengandung dua cincin benzena yang dihubungkan dengan 3 atom karbon dan dirapatkan oleh sebuah atom oksigen.

    • Flavonoid murni artinya tidak mengandung senyawa lain terdiri dari : antosianin yaitu pigmen yang berwarna merah, biru dan ungu, antoxantin yang memberikan warna kuning, dan tanin yang berwarna coklat.


    Antosianin
    Antosianin mudah berubah menjadi coklat bila berhubungan dengan asam sebab atom Mg akan diganti dengan atom H sehingga terbentuk senyawa yang disebut Feofitin.

    • Terdapat dalam jaringan tanaman dalam bentuk glikosida baik berikatan satu monosakarida atau dua monosakarida.

    • Karbohidrat yang berikatan dengan antosianin adalah : glukosa, galaktosa, ramnosa dan kadang-kadang pentosa.

    • Umumnya antosianin larut dalam air dan hanya bila dididihkan dengan asam encer akan terurai menjadi antosianidin dan monosakarida.


    Pengaruh pengolahan dan pemasakan
    Pengaruh pengolahan dan pemasakan mudah berubah menjadi coklat bila berhubungan dengan asam sebab atom Mg akan diganti dengan atom H sehingga terbentuk senyawa yang disebut Feofitin.

    • Buah-buahan dan sayuran yang mengandung antosianin umumnya mengalami problem bila diolah. Hal ini disebabkan pigmen tersebut mudah larut sehingga dalam pemasakan akan terjadi kemungkinan pelarutan pigmen tersebut. Namun bila pigmen berada kuat dalam jaringan maka warna tidak akan hilang.


    • Pemberian asam juga akan mempengaruhi warna. Misalnya dalam pengolahan kubis merah perlu digunakan air dengan basa yang tinggi misalnya dengan pemberian NaHCO3, maka warna kubis akan menjadi hijau.

    • Dalam pengalengan buah atau sayur yang banyak mengandung antosianin maka kaleng perlu dilapisi dengan epoxy agar tidak terjadi perubahan warna.


    Antoxantin dan flavon
    Antoxantin dan Flavon pengolahan kubis merah perlu digunakan air dengan basa yang tinggi misalnya dengan pemberian NaHCO

    • Kedua macam pigmen tersebut memberikan warna kuning pada produk pertanian dan terdapat dalam jaringan sel.

    • Antoxantin merupakan glikosida dengan satu atau dua monosakarida yaitu ramnosa dan glukosa.

    • Pemanasan dengan asam encer akan memecahkannya menjadi flavon dan turunannya (flavon, flavonol, dan isoflavon) dan monosakarida.



    Tanin
    Tanin merupakan contoh antoxantin dalam produk pertanian.

    • Tanin disebut juga asam asam tanat dan asam galotanat.

    • Tanin dapat bereaksi dengan ion dan membentuk warna gelap yang banyak digunakan untuk membuat tinta.

    • Tanin mudah sekali dioksidasi dengan permanganat dan dapat dititrasi.


    • Tanin yang banyak terdapat di pasaran terdiri dari sembilan molekul asam galat dan sebuah molekul glukosa.

    • Tanin terdiri dari katekin, leukoantosianin dan asam hidroksi.

    • Senyawa yang banyak digunakan dalam penyamakan kulit adalah katekin dengan berat molekul besar sedangkan yang terdapat dalam buah dan sayuran adalah yang berat molekulnya kecil.



    Karotenoid
    Karotenoid anggur, dan pir.

    • Karotenoid adalah zat warna kuning oranye dan merah oranye yang larut dalam lemak tetapi tidak larut dalam air.

    • Karotenoid berada dalam lemak bersam-sama dengan klorofil.

    • Karotenoid merupakan senyawa polimer dari isoprena dengan rumus C5H8.


    • Karotenoid umumnya terdiri dari 40 atom karbon dari delapan unit isoprena. Beberapa molekul mengandung rantai karbon tak jenuh dan berakhir dengan ring.

    • Karoten banyak terdapat dalam wortel, apel, dan paprika. Biasanya berada dalam bentuk bebas tetapi kadang-kadang bercampur dengan alfa dan gamma karoten. Alfa dan Beta karoten berbeda pada ikatan rangkap ring kedua.

    • Karoten adalah prekusor vitamin A, karena bila dihidrolisis akan menghasilkan vitamin A.


    Pewarna sintetis
    PEWARNA SINTETIS unit isoprena. Beberapa molekul mengandung rantai karbon tak jenuh dan berakhir dengan ring.

    • Tartrazin (kuning),

    • Amaranth  merah

    • Sunset yellow  orange

    • Briliant blue FCF  biru

      Kelebihan: Pilihanwarnabanyak, praktis

      Kekurangan : Tidakmenghasilkan aroma,

      Adapewarna yang tidakcocokuntuk

      makanandanberesikomenimbulkan

      penyakit


    Perwarna tekstil
    PERWARNA TEKSTIL unit isoprena. Beberapa molekul mengandung rantai karbon tak jenuh dan berakhir dengan ring.

    Terkadangorangmempergunakanpewarnatekstikuntukmewarnaimakanan. Warnanyasangatmenyolokdantampakbagus. Tetapisangatberbahayabagikesehatan.

    Beberapapewarnasintetissudahdilarangdigunakanuntukmakanan, misalnya :

    Rodhamin B,

    Karenamenyebabkaniritasipadasaluranpernafasan, iritasipadakulit, iritasipadamata, iritasisaluranpencernaandanbahayakankerhati.

    metanil yellow,

    Menyebabkan : iritasipadasaluranpernafasan, iritasipadakulit, iritasipadamata, danbahayakankerpadakandungdansalurankemih


    Zat warna tertentu yg dinyatakan sebagai bahan berbahaya
    Zat unit isoprena. Beberapa molekul mengandung rantai karbon tak jenuh dan berakhir dengan ring.warnatertentuygdinyatakansebagaibahanberbahaya


    ad