'Tree topology' presentation slideshows

Understanding Operating Systems Fifth Edition

Understanding Operating Systems Fifth Edition. Chapter 9 Network Organization Concepts. Basic Terminology. Network Collection of loosely coupled processors Interconnected by communication links Using cables, wireless technology , both Common goal Provide convenient resource sharing

1.2k views • 57 slides

Phylogeny II : Parsimony, ML, SEMPHY

559 views • 44 slides

6.1

6.1. Chatper 6 Maximum-likelihood Tree-puzzle. The concept of likelihood refers given some data D, a decision must be made about an adequate explanation of the data .

567 views • 42 slides

Phylogenetic Tree Reconstruction

I519 Introduction to Bioinformatics, 2012. Phylogenetic Tree Reconstruction. Evolution theory. Speciation Evolution of new organisms is driven by Mutations The DNA sequence can be changed due to single base changes, deletion/insertion of DNA segments, etc. Selection bias

962 views • 40 slides

Computer Networks

Computer Networks. Done By: Sulaiman Qeshta Ahmed Faris Ahmed Al-Abadelah Jehad Tabash Huseen Abu Yousif. Objectives. Learning about: Networks and its benefits Types of Networks Network Technologies Topologies Network Devices Networks Cabling. Networks.

554 views • 37 slides

Network Topologies & Devices

Network Topologies & Devices. Star Topology. Star Topology. Star Networks are one of the most common network topologies. consists of one central switch , hub or computer, which acts as a conduit to transmit messages.

628 views • 34 slides

ZigBee

634 views • 29 slides

Multiple Sequence Alignment (MSA) and Phylogeny

Multiple Sequence Alignment (MSA) and Phylogeny. Clustal X. Input: multiple sequence Fasta file. >gi|21536452|ref|NP_002762.2| mesotrypsin preproprotein [Homo sapiens] MNPFLILAFVGAAVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQ

405 views • 28 slides

Photo Album

712 views • 24 slides

VoIP Applications for the Small Business

529 views • 23 slides

NETWORK TOPOLOGY

NETWORK TOPOLOGY. NETWORK TOPOLOGY The layout of a network. Two major classes Physical Network Topology The physical layout of the network i.e. the arrangement and order of the network devices Logical Network Topology ( Signal Topology )

13.48k views • 23 slides

NETWORK TOPOLOGY

NETWORK TOPOLOGY. NETWORK TOPOLOGY The layout of a network. Two major classes Physical Network Topology( Signal Topology ) The physical layout of the network i.e. the arrangement and order of the network devices Logical Network Topology

1.52k views • 23 slides

Spanning tree Protocol (STP) Variants

400 views • 22 slides

Probabilistic Approaches to Phylogenies

Probabilistic Approaches to Phylogenies. BMI/CS 576 www.biostat.wisc.edu/bmi576.html Sushmita Roy sroy@biostat.wisc.edu Oct 2 nd , 2014. Readings. Chapter 8 Sections 8.1, 8.2, 8.3, 8.4. Key concepts. Scoring a tree based on likelihood of observed data

341 views • 22 slides

Based on presentations by Dan Geiger, Shlomo Moran, and Ido Wexler. Modified by Benny Chor.

Comput. Genomics, Lecture 5b Character Based Methods for Reconstructing Phylogenetic Trees: Maximum Parsimony. Based on presentations by Dan Geiger, Shlomo Moran, and Ido Wexler. Modified by Benny Chor. References: Durbin et al 7.4, Gusfield 17.1-17.3, Setubal&Meidanis 6.1.

348 views • 21 slides

Network Topology

Network Topology. LAN (Local Area Network) A group of computers and associated devices (printers, etc.) connected through a wired or wireless medium by networking devices (hubs, switches, routers) u se protocols for communication. Review : Computer Network. Objectives. Topology

1.03k views • 17 slides

Phylogeny and Genome Biology

Phylogeny and Genome Biology. Andrew Jackson Wellcome Trust Sanger Institute. Changes: Type program name to start Always Cd to phyml directory before starting program Beware phyml overwrites tree file with every search Ctrl C quits phyml and restores terminal

254 views • 17 slides

INTRODUCTION TO COMPUTER NETWORKS

Dr. Robert Steven Owor. INTRODUCTION TO COMPUTER NETWORKS. Introduction to Computer Networks. INTRODUCTION TO COMPUTER NETWORKS. Introduction to Computer Networks. LAN, MAN & WAN. Network in small geographical Area (Room, Building or a Campus) is called LAN (Local Area Network)

587 views • 15 slides

Xilinx Virtex-5 FPGA Clocking

Xilinx Virtex-5 FPGA Clocking. Presented by: Wesley Holland. Global Clock Lines. Each Virtex-5 device has 32 global clock lines (GCLs) for clocking sequential resources GCLs are available anywhere on chip

493 views • 6 slides

Star Topology

Star Topology. Ring Topology. Bus Topology. Mesh Topology. Tree Topology.

603 views • 3 slides