'Tandem mass spectrometry' presentation slideshows

Protein Sequencing and Identification by Mass Spectrometry

Protein Sequencing and Identification by Mass Spectrometry. Outline. Introduction to Protein Structure Peptide Mass Spectra De Novo Peptide Sequencing Spectrum Graphs Protein Identification via Database Search Spectral Convolution Spectral Alignment Problem.

2.14k views • 142 slides

Frederick SANGER (1918-)

1958 Nobel Prize in Chemistry: for his work on the structure of proteins, especially that of insulin. GIVEQCCASVCSLYQLENYCN PVNQHLCGSHLVEALYLVCGERGFFYTPKA. Frederick SANGER (1918-).

1.25k views • 81 slides

Expanded Newborn Screening: Public Health Policy and Clinical Impact

Expanded Newborn Screening: Public Health Policy and Clinical Impact. Nutrition 526 October 26, 2011 Beth Ogata, MS, RD, CSP, bogata@uw.edu Cristine M Trahms , MS, RD, FADA. Newborn Screening.

969 views • 73 slides

Statistical Significance for Peptide Identification by Tandem Mass Spectrometry

Statistical Significance for Peptide Identification by Tandem Mass Spectrometry. Nathan Edwards Center for Bioinformatics and Computational Biology University of Maryland, College Park. Mass Spectrometry for Proteomics. Measure mass of many (bio)molecules simultaneously High bandwidth

1.04k views • 64 slides

?????? 93 ???????? ???????

941 views • 46 slides

CSE280a: Projects

CSE280a: Projects. Vineet Bafna. Project Logisitics. Research project (70%) Work individually, or in groups of 2 Two presentations: Introductory presentation: Feb 1st week (20 minutes) (20% grade) Describe the goals of the project Describe your (computational) formulation

491 views • 41 slides

PEAKS: De Novo Sequencing using Tandem Mass Spectrometry

632 views • 35 slides

Improving the Similarity Search of Tandem Mass Spectra using Metric Access Methods

349 views • 17 slides

Presented by: Allison Anguren and Priya Vasudeva

Presented by: Allison Anguren and Priya Vasudeva. Introduction. Metabolomics the quantitative measurement of the dynamic metabolics response of living systems to pathophysiological stimuli, environmental modulation, or genetic modifications

309 views • 14 slides

Physical Methods to Characterize Proteins

Physical Methods to Characterize Proteins. Physical properties of key interest. Molecular weight. Oligomerization state. Structure. Interactors. Transport Processes. 1. Transport in an electric field ( electrophoresis ).

432 views • 10 slides

Summary of Session II

Tandem Mass Spectrometry in Newborn Screening. Summary of Session II. John E. Sherwin, Ph.D. California Department of Health. Reporting is Communication. Report should include a reference range Range should be from an appropriate cohort

177 views • 7 slides

0654118e_Boebinger

High Performance Mass Spectrometry: FT-ICR at 14.5 T Gregory S. Boebinger, National High Magnetic Field Laboratory DMR 0654118 Ion Cyclotron Resonance User Program, Florida State University.

100 views • 2 slides