Skip this Video
Download Presentation
Nothing in ( computational ) biology makes sense except in the light of evolution

Loading in 2 Seconds...

play fullscreen
1 / 43

Nothing in computational biology makessense except in the light of evolution - PowerPoint PPT Presentation

  • Uploaded on

Using (and abusing) sequence analysis to make biological discoveries . Nothing in ( computational ) biology makes sense except in the light of evolution. after Theodosius Dobzhansky (1970). Significant sequence similarity is evidence of homology.

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'Nothing in computational biology makessense except in the light of evolution' - salena

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

Using (and abusing) sequence analysis to

make biological discoveries

Nothing in (computational) biology makes

sense except in the light of evolution

after Theodosius Dobzhansky (1970)


Significant sequence similarity is evidence of homology

Only a small fraction of amino acid residues is directly

involved in protein function (including enzymatic);

the rest of the protein serves largely as structural


Conserved sequence motifs are determinants of

conserved ancestral functions


Pre-sequencing era (before 1978-80)

Study biological function

Pre-genomic era (1980-1996)

Study biological function

Clone/sequence gene

Analyze/interpret sequence

Post-genomic era (1996-

Analyze/interpret sequences

of all genes

Sequence genome

Study biological function

Prioritize targets

The evolving roles of computational analysis in biology


Sequence complexity

Measure of the randomness of a sequence

Random sequence - highest complexity (entropy) -

globular protein domains

Homopolymer - lowest complexity (entropy) -

non-globular structures

Algorithmic complexity



ASDFGHKLCVNM - random sequence - no algorithm to derive

from a simpler one


seg BRCA1 45 3.4 3.7 > BRCA1.seg

>gi|728984|sp|P38398|BRC1_HUMAN Breast cancer type 1 susceptibility protein














sdellgsddshdgesesnakvadvldvlne 389-458






ktpeminqgtnqteqngqvmnitnsghenk 527-635
















knlleenfeehsmsperemgnenipstvst 996-1089









sqstrhstvateclsknteenllslknsln 1239-1312



1313-1316 QDPF

Non-globular regions

Globular domains






sgslqnrnypsqeelikvvdveeqqleesg 1514-1616


















sgslqnrnypsqeelikvvdveeqqleesg 1514-1616














Paradigm shift in database searching



Set of homologs



Sequence database








PSSM database









homolog plant


REV1 yeast

DPB11 yeast





DNA ligase III

ATP-dep ligase



TdT eukaryotes




ATP and PCNA-binding

DNA ligase


NAD-dep ligase


Use of profile libraries to examine domain representation

in individual proteomes



Detect domains




Compare domain


Profile library



Chervitz SA, Aravind L, Sherlock G, Ball CA, Koonin EV, Dwight SS, Harris MA, Dolinski K, Mohr S, Smith

T, Weng S, Cherry JM, Botstein D. 1998. Comparison of the complete protein sets of worm and yeast:

orthology and divergence. Science 282: 2022-8


Normalized domain counts in worm and yeast

1.Hormone receptor; 2.POZ; 3.EGF; 4.MATH; 5.PTPase; 6.Cation Channels; 7.PDZ;

8.SH2; 9.FNIII; 10.Homeodomain; 11.LRR; 12.EF hands; 13.Ankyrin; 14.RING finger;

15.C2H2 finger; 16.small GTPase; 17.RRM; 18.AAA+; 19.C6 finger


Searching a domain library is often easier and more informative

  • than searching the entire sequence database. However, the latter
  • yields complementary information and should not be skipped
  • if details are of interest.
  • Varying the search parameters, e.g. switching composition-based statistics
  • on and off, can make a difference.
  • Using subsequences, preferably chosen according to objective criteria,
  • e.g. separation from the rest of the protein by a low-complexity linker,
  • may improve search performance.
  • Trying different queries is a must when analyzing protein (super)families.
  • Even hits below the threshold of statistical significance often are worth
  • analyzing, albeit with extreme care. Transferring functional information
  • between homologs on the basis of a database description alone is dangerous.
  • Conservation of domain architectures, active sites and other features
  • needs to be analyzed (hence automated identification of protein families is
  • difficult and automated prediction of functions is extremely error-prone).
  • Always do a reality check!