
Makalah bahasa indonesia Kata dan diksi (kata pilihan) dosen : susandi

/ 20 []
Download Presentation
(984) |   (0) |   (0)
Views: 125 | Added: 01-01-2013
Rate Presentation: 1 0
Makalah bahasa indonesia Kata dan diksi (kata pilihan) dosen : susandi. Sekolah tinggi manajemen informatika dan komputer Stmik asia malang. KATA PENGANTAR.
Makalah bahasa indonesia Kata dan diksi (kata pilihan) dosen : susandi

An Image/Link below is provided (as is) to

Download Policy: Content on the Website is provided to you AS IS for your information and personal use only and may not be sold or licensed nor shared on other sites. SlideServe reserves the right to change this policy at anytime. While downloading, If for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Slide 1

Makalah bahasa indonesiaKata dan diksi (kata pilihan)dosen : susandi

Sekolah tinggi manajemen informatika dan komputer

Stmik asia malang

Slide 2


Dewasa ini didalam berbahasa indonesia, sering terdapat kerancuan dalam penulisan,ucapan maupun dalam struktur ejaan.Masing-masing orang mempunyai pemahaman dan pendapat yang berbeda-beda sehingga kadang terjadi kesalahpahaman dan membingungkan mana yang sesungguhnya benar.Terutama dalam pemakaian dan pemilihan kata,biasanya sulit untuk membedakan mana kata yang baku dan tudak baku seperti aturan-aturan yang ada didalam EYD-Ejaan Yang Disempurnakan.

Oleh karena itu didalam makalah ini,kami akan mencoba membahas dan menjelaskan tentang makna kata dan pemilihan kata (diksi).Bahasa indonesia dalam perkembangannya memang telah mengalami pasang surut.Pemakaian kata dan struktur ejaannya sering dikacaukan karena mengikuti perkembangan jaman.Bahkan atas nama modernisasi,orang jadi cenderung malu untuk menggunakan bahasa indonesia dengan baik dan benar.

Makalah ini diharapkan bisa menambah wawasan bagi pembaca dan bagi yang masih peduli dengan penggunaan bahasa indonesia dengan baik dan benar.kami menyadari makalah ini masih jauh dari tahap sempurna,oleh karena itu saran dan kritik yang membangun yang kami harapkan untuk bisa lebih baik lagi.

Slide 3


  • Makna kata

  • Makna Donotatif

  • Makna Konotatif

  • Pengertian Diksi

  • Syarat Ketepatan Diksi

  • Gaya Bahasa Dan Idiom

  • Gaya Bahasa Eufinisme

  • Gaya Bahasa Hiperbola

  • Gaya bahasa metafora

  • Gaya bahasa personifikasi

  • Gaya bahasa Sarkasme

  • Gaya bahasa metonimia

  • Gaya bahasa Litotes

  • Gaya Bahasa pleonasme

  • Jargon dan Kata Slang

  • Jargon

  • Kata Slang

  • Contoh pilihan kata yang baik berdasarkan jenis kata :

  • Kata Kajian

  • Kata Populer



Slide 4



Makna Kata:

A.Makna Denotatif

Makna denotasi adalah makna yang sebenarnya yang sama dengan makna lugas untuk menyampaikan sesuatu yang bersifat faktual. Makna pada kalimat yang denotatif tidak mengalami perubahan makna.

Contoh :

1. Mas parto membeli susu sapi

2. Dokter bedah itu sering berpartisipasi dalam sunatan masal

B.Makna Konotatif

Makna konotasi adalah makna yang bukan sebenarnya yang umumnya bersifat sindiran dan merupakan makna denotasi yang mengalami penambahan


Para petugas gabungan merazia kupu-kupu malam tadi malam (kupu-kupu malam = wts)

Bu Marcella sangat sedih karena terjerat hutang lintah darat (lintah darat = rentenir)

Slide 5

  • Pengertian Diksi

    Diksi dalam arti aslinya dan pertama, merujuk pada pemilihan kata dan Gaya ekspresi oleh penulis atau pembicara. Dan menurut Kamus Besar Bahasa Indonesia, diksi berarti "pilihan kata yang tepat dan selaras (dalam penggunaannya) untuk mengungkapkan gagasan sehingga diperoleh efek tertentu (seperti yang diharapkan)”. Dari pernyataan itu tampak bahwa penguasaan kata seseorang akan mempengaruhi kegiatan berbahasanya, termasuk saat yang bersangkutan membuat karangan. Setiap kata memiliki makna tertentu untuk membuat gagasan yang ada dalam benak seseorang. Bahkan makna kata bisa saja “diubah” saat digunakan dalam kalimat yang berbeda. Hal ini mengisyaratkan bahwa makna kata yang sebenarnya akan diketahui saat digunakan dalam kalimat. Lebih dari itu, bisa saja menimbulkan dampak atau reaksi yang berbeda jika digunakan dalam kalimat yang berbeda.

Slide 6

Syarat Ketepatan Diksi

Syarat Ketepatan Diksi ialah pilihan kata. Maksudnya, kitamemilihkata yang tepatuntukmenyatakansesuatu. Pilihan kata merupakan satu unsur sangat penting, baik dalam dunia karang – mengarang maupun dalam dunia tutur setiap hari. Dalam memilih kata yang setepat-tepatnya untuk menyatakan suatu maksud, kita tidak dapat lari dari kamus. Kamus memberikan suatu ketepatan kekpada kita tentang pemakaian kata-kata. Dalamhalini, maknakata yang tepatlah yang diperlukan.

Gaya Bahasa dan Idiom

Cara mengungkapkan pikiran melalui bahasa secara khas yang memperlihatkan jiwa dan kepribadian penulis atau pemakai bahasa. (Tarigan)

Slide 7

  • Gaya bahasaeufinisme

    Eufemismeataupenghalusanbahasaadalahsalahsatubentukpemakaianbahasadalammasyarakat yang sudahsemakinlancarpenggunaanya. Mungkinkarenatuntutanzaman yang mengharuskanataukarenapolapikirmasyarakatpemakaibahasa yang selaluberubah. Kelancaranpenggunaanbahasatersebutmerupakanakibatdarikebebasanberbahasa yang dimilikiolehsetiapindividutanpaadaaturan yang mengikat. Kebebasanitudiartikansebagaisebuahkesempatanuntukberekspresimelaluibahasa. Memanghalinidapatmembericoraktersendiridalamrekamansejarahperjalananbahasaindonesiaditengah-tengahbanyaknyapenggunaanbahasadaerahsertamaraknyapenggunaanbahasaasingsebagaisalahsatukebanggaantersendiribagipemakainya. Selainitu, kebebasanberbahasainijugasangatditentukanolehprinsippragmatiksebuahbahasa. Padadasarnyaprinsipinimengartikanbahwabahasabukansebagaisebutanaturan yang dapatmengikatsetiappemakainyatetepilebihmenitikberatkanpadabahasasebagaialatkomunikasibagiindividu. Aturanatauejaanditempatkanpadanomor yang paling bawah, yang terpentingbagaimanabahasaitudapatdimengertiolehorang yang membacaataumendengarnya. Salahsatubentukkebebasantersebutadalahpenggunaangayabahasatersendiriolehsetiapindividu.

Slide 8

Gaya bahasatersebutbukanlagidilihatdarijeniskelompoksosialpemakainyaterkadanggayabahasaperorangan yang menonjol. Istilahsosiolinguistikmengatakanbahwagayabahasaseperti yang dipraktikkansetiapindividutersebutdisebutidiolekiniadalahseseorangdapatdiketahuihanyadengangayabahasanya yang khasdanunuk. Ilmupsikolinguistikdapatdenganjelasmembedakangayabahasainiterkaitdenganjiwaataukebiasaanseseorang. Hanyalewatbahasaseseorangdapatdenganmudahdiketahuikarakternya. Kembalikepersoalankebebasabberbahasa yang selaludiikutiolehmunculnyagayabahasatersendiri. Eufemismemerupakanacuan yang berupaungkapan yang tidakmenyinggungperasaanatauungkapanhalusuntukmenggantikanacuan yang dirasakanmenghinaatautidakmenyenangkan. Intinya, mempergunakankata-katadenganartibaikataudengantujuanbaik. Eufemismejugaada yang mengartikansebagaiungkapan yang bersifattidakberterusterang. Eufemismeataujuga pseudo eufemismemenjadi motif dorongandibelakangperkembanganpeyorasi. Eufemismeberlatarbelakangsikapmanusiawikarenadiaberusahamenghindar agar tidakmenyakitiataumenyinggungperasaanorang lain. Seandainyatidakadaeufemismemungkinakanterjadidepresimaknaatauperendahan.

Slide 9

Namundibaliksemuaitu. eufemismeinidapatmengaburkanmaknasehinggamaknasemulatidakterwakililagiolehbentukataukonsep yang menggantikannya. Pergeseranmaknainitentuakanmemberikanpengaruhterhadapmasyarakatpemakaibahasa. Terkadangadasebagianeufemisme yang penggunaannyasudahberlebihansehinggaapa yang ingindisampaikantidakdapattertangkapsecaratepatolehpembacaataupendengar. Memengtujuaneufemismetersebutadalahuntukbersopansantunadapenipuan. Olehkarenaitu, dapatdikatakanbahwaeufemismeadalahsopansantun yang menipu. Hal initidakbisadipungkirikarenabanyakorang-orangtertentu yang pandaimenggunakanbahasa, berlindungdibalikeufemismeini. Sehinggabanyak pula diantarapenggunaanyamerasaamandenganpemanfaatangayabahasasepertiini. Salahsatucontoheufemisme yang berlebihanadalahfrasakekuranganpangan. Frasainikonsepsebenarnyaadalahkelaparan. Tetapikarenapenggunaannyaberlebihansehinggaeufemismeinimenimbulkanmaknaataukonsep lain terhadappembaca.

Slide 10

Konsep lain ini muncul karena danya pergeseran makna dari makna sebelumnya. Akhirnya masyarakat pembaca menganggap hal ini adalah sebuah kewajaran dan tidak menimbulkan rasa prihatin terhadap korban kelaparan yang dimaksud. Pada masa orde baru pemerinteh merasa riskan mengatakan rakyat miskin dan mereka cenderung menggantikannya atau mengeufemismekan dengan frasa masyarakat prasejahtera, masyarakat prasejahtera 1 dan 2. akhirnya, dampak yang dirasakan melalui pemggunaan eufemisme ini, negara Indonesia terkesan tidak memiliki rakyat miskin karena dunia terbohongi oleh sebuah bahasa. Namun apa yang terjadi sekarang, semua hal itu terhapuskan setelah bangsa indonesia memasuki orde reformasi. Rakyat miskin atau keluarga miskin justry menjadi predikat rebutan setiap masyarakat karena siapapun yang tergolong di dalamnya pasti akan mendapatkan BTL atau bantuan langsung tunai. Sekarang banyak yang mengaku sebagai keluarga miskin. Frasa keluarga prasejahtera kini tergantikan dengan keluarga miskin atau diakronimkan menjadi gakin.

Slide 11

Eufemismeinidapat pula syaratakankepentingangolonganatau yang bernilaipolitis. Sepertiwaktu yang lalu, ketikamenjelangpilkadagubernur, sangatrawandenganbahasa-bahasapenghalusan yang saratdengankepentingan-kepentingantertentuatraukepentinganpolitik. Banyakkandidat yang berkampanyaedenganmenunggangibahasasebagaialatuntukmencapaitujuan. Dahulu, kenaikanhargabahanpokokselaluditentangdenganaksi demo atauunjuk rasa olehmasyarakat. Namunsekarangaksi-aksiunjuk rasa itudapatdiredamhanyadenganduakatayaknimenggantidenganfrasapenyesuaianhargadanpenyesuaiantarif. Orang-orang pun diammendengardanmembacanya. Akhirnyakenaikanhargadapatdimaklumi. BahkanketikakorupsimantanMentriKelautandanPerikanan era pamerintahan Megawati Soekarnopoetri yang barumencuattahuninidapatberhentibegitusajatanpaadapihakbersalah. Menurutberbagaipihak yang terkaitdengankasusuini, katanyakasusitutelahdiselesaikansecarakekeluargaan. Mungkinbisadibayangkan, jikasesuatu yang diselesaikansecarakekeluargaantentutidakadapihakbersalahataudijatuhihukuman. Frasadiselesaikansecarakekeluargaaninilah yang dapatmeredamdandapatmengaburkanmaknauntuktujuanataukepentingangolongantertentu. Misalnyakataberkoalisidieufemismekanmenjadibersilaturahmi, penggusuranmenjadipenertiban, kelaparanmenjadikekuranganpangan, busunglaparmenjadikuranggizi, dll.

Slide 12

  • Gaya BahasaHiperbola

    Gaya bahasa yang mengandung pernyataan yang melebih-lebihkan baik jumlah, ukuran, ataupun sifatnya dengan tujuan untuk menekankan, memperhebat, meningkatakan kesan dan pengaruhnya.

    Contoh: Angkatlahpandangmatamu


    kesejutalilin alit

    yang gemetar

  • Gaya BahasaMetafora

    Gaya bahasaperbandingan yang membandingkanduahalasecara implicit. Metaforadibentukberdasarkanpenyimpanganmakna. Sebenarnya, sepertijugapada simile, dalammetaforaterdapatduabentukbahasa (penanda) yang maknanyadiperban-dingkan. Namun, disini, sebagaimanadikatakanolehKerbratOrecchioni, salahsatuunsurbahasa yang dibandingkanitutidakmuncul, melainkanbersifatimplisit. Sifatimplisitinimenyebabkanadanyaperubahanacuanpadapenanda yang digunakan. Selainitu, tidakadakata yang menunjukkanperbandingansepertidalam simile. Hal-halinilah yang mungkinmenjadimasalahdalampemahamanmetafora.

Slide 13


  • Banyakmahasiswa yang mencobamemperebutkanmawarfakultasIlmuPengetahuanBudayaitu.

  • Padakalimatdiatas, katamawardigunakanuntukmenyebutgadis. Iniberarti, keduanyadiperbandingkan. Komponenmaknapenyama: cantik/indah, segar, harum, berduri, cepatlayu.

  • Komponenmaknapembeda: untuk “gadis” adalahmanusia, berjeniswanita,

  • untuk “mawar” adalahbagiandaritanaman

  • Berikutiniakandikemukakan pula bagansegitigasemantikmetafora

  • Contoh: Akuadalahburung yang terbangbebas

Slide 14

  • Gaya BahasaPersonifikasi

    Adalahgayabahasa yang menampilkanbinatang, tanaman, ataubendasebagaimanusia.


  • “Melambai-lambai, nyiurdipantai” (cuplikanlagu Tanah airku Indonesia)

  • Unsur yang dibandingkan: “gerakantangan” dengan “gerakandaunnyiur”.

  • Komponenmaknapenyama: „gerakan‟, „bagiandarisesuatu yang besar‟ (tangan/daun)

  • Komponenmaknapembedauntuktanganadalahbagiandari „manusia‟.

  • Komponenmaknapembedauntukdaunnyiuradalah „tanaman‟. Di sini yang munculhanyagerakandaunnyiur, sedangkangerakantanganmanusiamenjadiimplisit. Acuan pun berubah, yang melambaibukanlagitanganmanusia, melainkandaunnyiur.

  • Gaya BahasaSarkasme

    Adalahgayabahasa yang paling kasar, bahkankadang-kadangmerupakankutukan.

    Contoh : Mampuspunakutakpeduli, diberinasihatakutakpeduli, diberinasihatmasukketelinga.

Slide 15

  • Gaya BahasaMetonimia

    Metonimiaialahgayabahasa yang menggunakannamabarang, orang, hal, atau cirri sebagaipenggantibarangitusendiri.

    Contoh: Parker jauhlebihmahaldaripada pilot

  • Gaya Bahasa Litotes

    Gaya bahasa yang berupa pernyataan yang bersifat mengecilkan kenyataan yang sebenarnya.

    Contoh: Apa yang kami berikan memang tidak berarti bagimu

  • Gaya BahasaPleonasme

    Adalahgayabahasa yang memberikanketerangandengankata-kata yang maknanyasudahtercakupdalamkata yang diterangkanataumendahului.

    Contoh : Darahmerahmembasahibajudantubuhnya

Slide 16

  • Jargon Dan Kata Slang

  • Jargon

    Jargon mengandung beberapa pengertian. Pertama, jargon adalah kata kata yang mengandung makna suatu bahasa, dialek, atau tutur yang dianggap kurang sopan atau aneh. Kedua, jargon diartikan sebagai bahasa yang timbul dari percampuran bahasa-bahasa, dianggap sebagai bahasa perhubungan. Ketiga, jargon diartikan sebagai kata-kata teknis atau rahasia dalam suatu bidang tertentu.

  • Kata Slang

    Kata slang adalahkatapercakapan yang tinggiataumurni. Kadang, kataslangdihasilkandarisalahucap yang disengaja, ataukadangberupapengrusakansebuahkatabiasauntukmengisisuatubidangmakna yanglain.

    Contoh Slang : asoy, manatahan, belumtahu, dia, dan sebagainya (bersifatsementara)

Slide 17

  • Contoh pilihan kata yang baik berdasarkan jenis kata (kata kajian dan kata popular).

  • Kata Populer adalah kata yang dikenal dan diketahui oleh seluruh lapisanmasyarakat. Contoh: kata gelandangan lebih dikenal daripada kata tunakarya.

Slide 19


(, diaksestanggal 24 november 2010).

(, diakses tanggal 24 november 2010)

( , diakses tanggal 24 november 2010)

(, diakses tanggal 25 november 2010)

(, diakses tanggal 25 november 2010)

(, diakses tanggal 25 november 2010)

(, diakses tanggal 26 november 2010)

(, diakses tanggal 26 november 2010)

(, diakses tanggal 26 november 2010)

(, diakses tanggal 26 november 2010)

Slide 20

Sekian dan terima kasih

Copyright © 2014 SlideServe. All rights reserved | Powered By DigitalOfficePro