Teori RASIONALITAS KEJAHATAN
Download
1 / 19

Teori RASIONALITAS KEJAHATAN - PowerPoint PPT Presentation


  • 118 Views
  • Uploaded on

Teori RASIONALITAS KEJAHATAN.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' Teori RASIONALITAS KEJAHATAN' - rosemary-mayo


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

Kuliah pada sessi ini akan mempelajari tentang bagaimana suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan.

Abstraksi


Ada apa dengan kasus gayus
Ada suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan. ApaDenganKasusGayus?

  • Rasionalitasmerupakansuatupertimbanganataskesadaranterhadapsuatupilihanbagiseseoranguntukbertindakatasdasarpreferensi (nilai, utilitas). Setiaporangberusahamemaksimumkan benefit danmeminimumkanresiko. Aspek-aspek yang menjadipertimbangandalamtindakanrasionaladalah :

  • KelangkaanSumberdaya

  • Biayaopportunitas

  • Norma-normainstitusional :keluarga, peer group dll

  • Aksesinformasi

  • Untukmelakukantindakanrasionalseseorangmelakukan :

  • Utilitasdimaksimumkan

  • Preferensidistruktur

  • Keputusandilakukandenganmeminimalkanresiko

  • Individusebagaisentral

  • Seorang penjahat sebelum melakukan perbuatannya melakukan evaluasi menyangkut:

    • Probabilita untuk ketahuan dan tertangkap

    • Seriusitas penghukuman yang mungkin dijatuhkan

    • Nilai potensial dari jaringan kejahatan yang ada

    • Kebutuhan jangka pendeknya terhadap hasil kejahatan

  • Penentunya adalah banyaknya informasi dan persepsi pelaku terhadap perbuatan jahat tertentu. Kapan seseorang tidak melakukan kejahatan?

  • Jika pendapatan yang diperoleh dari hasil kejahatan di masa depan akan menurun

  • Kesempatan untuk memperoleh penghasilan secara legal tetap tersedia


Pengertian teori ekspektasi rasional
Pengertian suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan. TeoriEkspektasiRasional

Teori ekspektasi rasional (rational expectations) diajukan pertama kali oleh John F. Muth pada tahun 1961 pada tulisannya yang berjudul “Rational Expectations and the Theory of Price Movements”. Teori ini kemudian dikembangkan oleh Robert E. Lucas Jr. untuk memodelkan bagaimana agen ekonomi melakukan peramalan di masa yang akan datang. Sukirno (2006) menjelaskan bahwa ada 2 asumsi yang menjadi dasar teori ekspektasi rasional (rational expectations). Pertama, teori ini menganggap bahwa semua pelaku kegiatan ekonomi bertindak secara rasional, mengetahui seluk beluk kegiatan ekonomi dan mempunyai informasi yang lengkap mengenai peristiwa-peristiwa dalam perekonomian

  • Keadaan yang  berlakudimasadepandapatdiramalkan, selanjutnyadenganpemikiranrasionaldapatmenentukanreaksiterbaikterhadapperubahan yang diramalkanakanberlaku. Akibatdariasumsiini, teoriekspektasirasionalmengembangkananalisisberdasarkanprinsip-prinsip yang terdapatdalamteorimikroekonomi yang jugabertitiktolakdarianggapanbahwapembeli, produsen, danpemilikfaktorproduksibertindaksecararasionaldalammenjalankankegiatannya. Asumsikeduaadalahsemuajenispasarberoperasisecaraefisiendandapatdengancepatmembuatpenyesuaian-penyesuaiankearahperubahan yang berlaku. Asumsikeduainisesuaidenganpendapatahli-ahliekonomiklasik, danmerupakansalahsatualasan  yang menyebabkanteoriinidinamakannew classical economics. Menurutasumsikedua, tingkathargadantingkatupahdapatdenganmudahmengalamiperubahan. Kekuranganpenawaranbarangakanmenaikkanharga, dankelebihanpenawaranmengakibatkanhargaturun. Buruh yang berkelebihanakanmenurunkanupah, sebaliknyakekuranganburuhakanmenaikkanupahmereka. Semuapasarbersifatpersaingansempurna, daninformasi yang lengkapakandiketahuiolehsemuapelakukegiatanekonomidiberbagaipasar.


Pendekatan rasionalitas kejahatan
Pendekatan suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan. RasionalitasKejahatan

TeoriRasionalKomprehensif

Barangkaliteoripengambilankeputusan yang biasadigunakandanditerimaolehbanyakkalanganadalahteorirasionalkomprehensif yang mempunyaibeberapaunsur :

Pembuatankeputusandihadapkanpadasuatumasalahtertentu yang dapatdibedakandarimasalah-masalah lain atausetidaknyadinilaisebagaimasalah-masalah yang dapatdiperbandingkansatusama lain (dapatdiurutkanmenurutprioritasmasalah)

Tujuan-tujuan, nilai-nilaiatausasaran yang menjadipedomanpembuatkeputusansangatjelasdandapatdiurutkanprioritasnya/kepentingannya.

Bermacam-macamalternatifuntukmemecahkanmasalahditelitisecarasaksama.

Asasbiayamanfaatatausebab-akibatdigunakanuntukmenentukanprioritas.

Setiapalternatifdanimplikasi yang menyertainyadipakaiuntukmembandingkandenganalternatif lain. Pembuatkeputusanakanmemilihalternatifterbaikuntukmencapaitujuan, nilai, dansasaran yang ditetapkan

Adabeberapaahliantara lain Charles Lindblom , 1965 (AhliEkonomidanMatematika) yang menyatakanbahwapengambilankeputusanitusebenarnyatidakberhadapandenganmasalah-masalah yang konkritakantetapimerekaseringkalimengambilkeputusan yang kurangtepatterhadapakarpermasalahan. Teorirasionalkomprehensifinimenuntuthal-hal yang tidakrasionaldalamdiripengambilkeputusan. Asumsinyaadalahseorangpengambilkeputusanmemilikicukupinformasimengenahiberbagaialternatifsehinggamampumeramalkansecaratepatakibat-akibatdaripilihanalternatif yang ada, sertamemperhitungkanasasbiaya manfaatnya.dan mempertimbangkanbanyakmasalah yang salingberkaitan.

Pengambilkeputusansering kali memilikikonflikkepentinganantaranilai-nilaisendiridengannilai-nilai yang diyakiniolehmasyarakat. Karenateoriinimengasumsikanbahwa fakta-2 dannilai-nilai yang adadapatdibedakandenganmudah, akantetapikenyataannyasulitmembedakanantarafaktadilapangandengannilai-nilai yang ada.


Pendekatan rasionalitas kejahatan1
Pendekatan suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan. RasionalitasKejahatan

TeoriRasionalKomprehensif

Barangkaliteoripengambilankeputusan yang biasadigunakandanditerimaolehbanyakkalanganadalahteorirasionalkomprehensif yang mempunyaibeberapaunsur :

Pembuatankeputusandihadapkanpadasuatumasalahtertentu yang dapatdibedakandarimasalah-masalah lain atausetidaknyadinilaisebagaimasalah-masalah yang dapatdiperbandingkansatusama lain (dapatdiurutkanmenurutprioritasmasalah)

Tujuan-tujuan, nilai-nilaiatausasaran yang menjadipedomanpembuatkeputusansangatjelasdandapatdiurutkanprioritasnya/kepentingannya.

Bermacam-macamalternatifuntukmemecahkanmasalahditelitisecarasaksama.

Asasbiayamanfaatatausebab-akibatdigunakanuntukmenentukanprioritas.

Setiapalternatifdanimplikasi yang menyertainyadipakaiuntukmembandingkandenganalternatif lain. Pembuatkeputusanakanmemilihalternatifterbaikuntukmencapaitujuan, nilai, dansasaran yang ditetapkan

Adabeberapaahliantara lain Charles Lindblom , 1965 (AhliEkonomidanMatematika) yang menyatakanbahwapengambilankeputusanitusebenarnyatidakberhadapandenganmasalah-masalah yang konkritakantetapimerekaseringkalimengambilkeputusan yang kurangtepatterhadapakarpermasalahan. Teorirasionalkomprehensifinimenuntuthal-hal yang tidakrasionaldalamdiripengambilkeputusan. Asumsinyaadalahseorangpengambilkeputusanmemilikicukupinformasimengenahiberbagaialternatifsehinggamampumeramalkansecaratepatakibat-akibatdaripilihanalternatif yang ada, sertamemperhitungkanasasbiaya manfaatnya.dan mempertimbangkanbanyakmasalah yang salingberkaitan.

Pengambilkeputusansering kali memilikikonflikkepentinganantaranilai-nilaisendiridengannilai-nilai yang diyakiniolehmasyarakat. Karenateoriinimengasumsikanbahwa fakta-2 dannilai-nilai yang adadapatdibedakandenganmudah, akantetapikenyataannyasulitmembedakanantarafaktadilapangandengannilai-nilai yang ada.


Pendekatan rasionalitas kejahatan2
Pendekatan suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan. RasionalitasKejahatan

TeoriInkremental

Teoriinidalammengambilkeputusandengancaramenghindaribanyakmasalah yang harusdipertimbangkandanmerupakanmadel yang seringditempuholehpejabat-pejabatpemerintahdalammengambailkeputusan. Teoriinimemilikipokok-pokokpikiransebagaiberikut:

Pemilihantujuanatausasarandananalisistindakanempiris yang diperlukanuntukmencapanyamerupakanhal yang salingterkait.

Pembuatkeputusandianggaphanyamempertimbangkanbeberapaalternatif yang langsungberhubungandenganpokokmasalah, danalternatif-alternatifinihanyadipandangberbedasecarainkrementalataumarjinal

Setiapalternatifhanyasebagiankecilsaja yang dievaluasimengenahisebabdanakibatnya.

Masalah yang dihadapiolehpembuatkeputusandiredifinisikansecarateraturdanmemberikankemungkinanuntukmempertimbangkandanmenyesuaikantujuandansaranasehinggadampakdarimasalahlebihdapatditanggulangi.

Tidakadakeputusanataucarapemecahanmasalah yang tepatbagisetiapmasalah. Sehinggakeputusan yang baikterletakpadaberbagaianalisis yang mendasarikesepakatangunamengambilkeputusan.

Pembuatankeputusaninkrementalinisifatnyadalahmemperbaikiataumelengkapikeputusan yang telahdibuatsebelumnyagunamendapatkanpenyempurnaan.

Karenadiambilberdasarkanberbagaianalisismakasangattepatditerapkanbaginegara-negara yang memilikistrukturmejemuk. Keputusandankebijakandiambildengandasarsalingpercayadiantaraberbagaipihaksehinggasecarapolitislebihaman. Kondisi yang realistikdiberbaginegarabahwadalammenagmbilkeputusan/kebijakanparapengambilkeputusandihadapkanpadasituasikurangbaiksepertikurangcukupwaktu, kurangpengalaman, dankurangnyasumber-sumber lain yang dipakaiuntukanalsissecarakomprehensif.


Pendekatan rasionalitas kejahatan3
Pendekatan suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan. RasionalitasKejahatan

Beberapaasumsi yang digunakandalamrasionalitaskejahatan :

Manusiaadalahmahlukrasional

Rasionalitsmencakupkalkukasitujuandancara

Kebebasanmemulihmenjadipenjahatatautidaktergantungpadakalkulasirasionalitas

Analisis B/C

Setiappilihanadalajmemaksimumkan benefit

Pilihandikontrololehpersepsidanpemahamantentangresiko/hukuman

Negara bertanggungjawabuntukmenjagaketertibanmelaluisistemhukum yang rasional

Ringan, beratdankeasptianhukummerupakanunsurkuncidalammengontrolpilihanjahat

Dalampengambilankeputusanatassuatutindakanrasional, makadapatdigunakan proxy kuantitatifsbb :

TS (TindakanSubyektif), p(Ek) (Probability EkspektasiKeberhasilan), p (Nk) (Nilaiygdiperoleh), p(R), (Probability Resiko/kegagalan))dan Nr (NilaiResiko). Sehinggadapatdiperolehrumus

TS= (p(Ek)xNk)-(p(R)xNr)

Dari rumusdiatasdapatdijelaskanbahwaseseorang yang akanmelakukankejahatanharusmempertimbangkanbeberapahal yang selanjutnyaakanmenghasilkankeputusan, apakahiaakanmelakukantindakpidanaataukahtidak. Inilah yang dimaksuddengan TS (TindakanSubyektif). Hal-hal yang harusdipertimbangkanadalah:

p(Ek) = seberapabesarkemungkinankeberhasilanrencanakejahatan

p (Nk)= seberapabesarkeuntungan (materi/kepuasan)yang akandiperoleh;

p(R), = seberapabesarkemungkinanresikoataugagalnyarencanakejahatandan;

Nr (NilaiResiko)= seberapabesarnilairesikoatauhukumankerugian yang akandideritamanakalakejahatan yang dilakukangagaldantertangkap.


Pendekatan rasionalitas kejahatan4
Pendekatan suatu perilaku penyimpang atau kejahatan merupakan sesuatu yang dilakukan secara rasional. Ada dasar pertimbangan seseorang untuk melakukan kejahatan dimana proses keputusannya sama seperti dalam bentuk perilaku normal. Setiap orang dapat dipandang memiliki kemampuan yang rasional dalam mengambil suatu keputusan. Teori rasionalitas kejahatan banyak mengadop teori ekonomi dan social tentang harapan rasional atas suatu tindakan. RasionalitasKejahatan

Contoh :

Seorang PNS memilikigajiRp 10 juta/bulan. DialaluditunjukutkmenjandipimprosuatuproyeksebesarRp 100 M. Diamenerima kick back sebesar 10% darikontraktor. Diaberfikir, apabilamengandalkangajimakatidakmungkindiaakanmampumengumpulkanuangmilyaran rupiah. kalkulasi yang dilakukanadalahapabiladiamenerima kick back tsb, maka:

Ekspectasimanfaat yang diperolehsebesarRp 10 M

Ekspektasiresikoadalah :

Membayarpolisi 1 M

MembayarJaksa 1 M

Membayar hakim 1 M

Membayarbiayaremisidi LP 500 jtmaka total pengeluaranadalahsebesar 3,6 M. dengandemikianekspektasimanfaat yang diperolehsebesar 6,5 M.


Pada dasarnya, setiap orang memiliki tujuan yang ingin dicapai (dalam hal ini pemenuhan materi) dan memiliki cara untuk mencapai tujuan tersebut. Idealnya, terdapat keserasian antara tujuan dan cara untuk mencapai tujuan melalui kapasitas dan kapabilitas yang dimiliki seseorang.

Means - Goals

Tujuan (Goals)

DistribusSumberDayaTidakMerata

Penyimpangan

Anomitas

Basis FaktorKriminogen

Cara (Means)


Tindakan dicapai (dalam hal ini pemenuhan materi) dan memiliki cara untuk mencapai tujuan tersebut. Idealnya, terdapat keserasian antara tujuan dan cara untuk mencapai tujuan melalui kapasitas dan kapabilitas yang dimiliki seseorang.Rasional

memaksimumkan benefit danmeminimumkanresiko

B/C > 1

  • Faktor-Faktor :

  • KelangkaanSumberdaya (adanya gap antarakapasitasdankapabilitasseseorang)

  • Biayaopportunitas (tradeoffdalammenilaisuatupilihan)

  • Norma-normainstitusional :keluarga, peer group dll

  • Aksesinformasi (penguasaaninformasi yang asimetris)

  • Kalkulasi rasionalitas korupsi didasarkan perhitungan analisis biaya-manfaat. Salah satu aspek yang dianggap sebagai manfaat (benefits) dari melakukan perbuatan korupsi adalah kemampuan “memanfaatkan” bobroknya sistem hukum dan lemahnya impelementasi terhadap perundang-undangan yang mengatur masalah korupsi. Pada kasus Gayus, dugaan kolaborasi antara oknum pengacara, polisi, jaksa dan hakim memperkuat argumen tersebut.


Sketsa Dugaan Kasus Gayus dicapai (dalam hal ini pemenuhan materi) dan memiliki cara untuk mencapai tujuan tersebut. Idealnya, terdapat keserasian antara tujuan dan cara untuk mencapai tujuan melalui kapasitas dan kapabilitas yang dimiliki seseorang.

Penegak Hukum

Internal Ditjen Pajak

Oknum hakim

Gayus

Perusahaan Wajib Pajak

Oknumjaksa

oknum Pengacara

Oknum Polisi

Tabel Neraca Benefit Cost Pada Pilihan Perilaku Rasionalitas Korupsi


Proses belajar
PROSES BELAJAR dicapai (dalam hal ini pemenuhan materi) dan memiliki cara untuk mencapai tujuan tersebut. Idealnya, terdapat keserasian antara tujuan dan cara untuk mencapai tujuan melalui kapasitas dan kapabilitas yang dimiliki seseorang.

Pengetahuan

Pengalaman

Preferensi

Utilitas

Proses Peniruan

Proses Belajar

  • asumsidalamteoribelajarsosial yang umumnyaterjadimelalui 5 (lima) tahap), yakni:

  • Adanyahubungan yang sangatdekatantaraparapihak (close contact);

  • Adanyapeniruanpadaorang yang memilikikelebihan (indikatornya : keberhasilanatauharapan yang sesuaidengan yang diinginkan);

  • Adanyapemahamanatassuatukonsep yang ingindipelajari (understanding of concepts);

  • Adanya model perilaku yang ditiru

  • Adanyapenegasanterhadaphal-hal yang dipelajari

Perilaku Korupsi


Gayus dengan tingkat pendidikan dan status sosial yang dimiliki tentunya sadar atas pilihan yang dilakukan, dengan mempertimbangkan kalkulasi rasionalitas. Terlepas dari aspek psikologis yang ada, Gayus, berada dalam struktur sosial dimana batas rasionalitas dan non rasionalitas semakin kabur. Kondisi masyarakat kekinian memang cenderung bias pada aspek pragmatisme. Dimensi ruang dan waktu seolah-olah menjadi sempit sehingga peluang memperoleh kekayaan materi harus diraih secepatnya. Sikap pragmatisme membawa efek berkembangnya nilai-nilai materialisme yang melahirkan sifat hedonis, rasa mementingkan diri sendiri dan individualistik. Pragmatisme menimbulkan format jalan pintas dalam mengejar kepemilikan materi. Menurut teori Behaviorisme, manusia merupakan produk lingkungan. Segala perilaku manusia sebagian besar akibat pengaruh lingkungan sekitarnya. Lingkunganlah yang membentuk kepribadian manusia. Behaviorisme tidak bermaksud mempermasalahkan norma-norma pada manusia. Apakah seorang manusia tergolong baik, tidak baik, emosional, rasional, ataupun irasional. Disini hanya dibicarakan bahwa perilaku manusia itu sebagai akibat berinteraksi dengan lingkungan, dan pola interaksi tersebut harus bisa diamati dari luar. Pengaruh lingkungan tidak jarang menimbulkan tekanan psikologis eksternal (strain) bagi seseorang untuk mengikuti pola kebiasaan dalam melakukan penyimpangan. Bahkan, tidak jarang apabila pengaruh tidak diikuti, maka orang itu dikucilkan atau dicemoohkan. Pada dasarnya, setiap orang memiliki tujuan yang ingin dicapai (dalam hal ini pemenuhan materi) dan memiliki cara untuk mencapai tujuan tersebut. Idealnya, terdapat keserasian antara tujuan dan cara untuk mencapai tujuan melalui kapasitas dan kapabilitas yang dimiliki seseorang. Pada prakteknya, terdapat berbagai upaya mencapai kesejahteraan (baca:kepemilikan materi) yang dilakukan oleh sebagian masyarakat melalui berbagai cara yang illegal. Kesempatan yang halal untuk memperoleh tujuan materialistik menurut Merton (1938) tidak terbagi rata bagi semua anggota kelompok kebudayaan. Sehingga banyak orang mencari jalan pintas untuk mencapainya.


Ikatan sosial (kelompok) menurut Hirschi memiliki 4 elemen utama: pertama, Attachment yakni Ikatan Sosial yang bersumber dari adanya sikap saling menghormati dan membutuhkan satu sama lain. Norma orang lain akan menjadi pula norma pribadi. Kedua, Commitment, yaitu sikap batin individu dalam pencarian hidup ideal yang diwujudkan dalam perbaikan karir dan upaya mengangkat nama baik yang lebih cemerlang di tengah-tengah masyarakat. Ketiga, Involvement yakni keterlibatan dalam kehidupan masyarakat (korps) secara wajar, menghindari untuk melakukan penyimpangan.Keempat, Belief yaitu suatu keyakinan dari individu terhadap nilai yang berkembang, yang kemudian diserap dalam perilaku. Dalam hal individu bersangkutan memandang bahwa nilai-nilai yang dihadapi dianggap merugikan dirinya, berpotensi ia melakukan penyimpangan. Contoh, hanya melihat komandan saja yang dapat hidup enak, maka ia akan melakukan berbagai macam cara, termasuk melepas tahanan, guna mendapatkan kehidupan yang dilihat sebagai lebih baik.Ringkasnya, apabila empat elemen tersebut lemah, maka berpotensi anggota suatu korps akan menciderai kesatuannya dengan melakukan pelanggaran hukum.


Lepasnya gayus
LEPASNYA GAYUS utama: pertama,

kesempatan yang halal untuk memperoleh tujuan materialistik tidak terbagi rata bagi semua anggota kelompok masyarakat, sehingga mereka menempuh jalan pintas untuk mengatasi permasalahan hidupnya, yaitu dengan cara menerima uang sogok.

SituasiAnomi

motif dilakukan pelanggaran hukum tersebut bersifat individual akibat adanya kebutuhan-kebutuhan pribadi.

Oknum Polisi Tergoda

  • Lemahnyaelemen-elemen :

  • Attachment

  • Commitment,

  • Involvement

  • Belief

Gayus Sebagai Subyek dan Obyek


Pola Peniruan utama: pertama,

Lemahnya Pengawasan

Oknum Polisi Tergoda

Korupsi Level Menengah - Bawah

Pertukaran Sosial Asimetris

(Faktor Kebutuhan)

Pembiaran atau Permissiveness

Posisi dan Kemampuan Finansial Gayus

  • Penjelasan

  • TerlibatnyaoknumpolisipenjagaRutanBrimobmengindikasikantelahterjadinyapenyebarankejahatankorupsihingga level bawah. Hal inidapatterjadiantara lain :

  • Adanyapolapeniruanolehaparatbirokrasiataupolisi level menengah – bawahterhadapperilakukorupsi yang dilakukanolehatasan. Terdapatsegmentasiperilakukorupsipada level tertentudenganmemanfaatkankewenanganataukekuasaan yang dimilikiolehaparatmasing-masing level.

  • Lemahnyapengawasandapatdiltinjaudariduasisiyakni (a) secaraeksternal, yakniketidakmampuanpublikuntukmengaksesbaikinformasimaupunaktifitaspenegakanhukum; (b) secaraeksternal, yakniketidakseriusankalangan internal dalammelakukanpengawasan. Kalaupundiketahuiadanyapenyimpangan, biasanyahukuman yang diberikanbersifatadministratif. Hal initidakmenimbulkanefekjera.

  • Berkaitandenganaspekke (2) telahterjadinyapembiaranolehatasan yang bertanggungjawabmelakukanpengawasandisebabkanadanyaindikasisalingmenutupidalammelakukankorupsi. Bahkan, tidakjarangterjadipembiaranterhadapkorupsi yang dilakukanolehaparat level menengah – bawahdengantujuanmembagikesempatankorupsidanadanyapolasetoranolehaparat level menengahbawahkepadaatasan


  • Pada utama: pertama, skemadiatasdapatdianalisadenganpendekatanpolapertukaransosial yang asimetrisdimanadimensikekuasaandimanfaatakangunamemaksabagipihak yang dilayaniuntukmengikutikebutuhanaparattersebut.

  • Pada dasarnya, pola pertukaran sosial dimulai dengan suatu proses interaksi yang bersifat penjajakan, dimana pihak-pihak yang mampu mengadakan pertukaran menunjukkan suatu perilaku alternatif dan atau reaksi yang datang dari masing-masing kepentingan para pihak hingga mereka sampai pada suatu kombinasi yang memuaskan kepentingan para pihak tersebut. Proses ini tidak perlu harus menjadi suatu hubungan sosial yang memuaskan para pihak. Hal ini tergantung pada posisi dan kepentingan masing-masing pihak sehingga bentuk hubungan dapat bersifat simetris atau asimetris. Pada hubungan sosial tertentu, dapat saja satu pihak menyatakan ketidakpuasan atas interaksi yang dijalankan sehingga dia merasa perlu mengundurkan diri dari proses suatu pertukaran sosial. Intinya, dalam suatu pertukaran sosial masing-masing pihak membawa kepentingan masing-masing yang diharapkan mampu bersinergi hingga membentuk suatu interaksi sosial yang diharapkan.

  • Kepentinganparapihak yang salingberinteraksidalamsuatupertukaransosialberangkatdariadanyasuatukebutuhan. Para pihakseyogyanyamampumemposisikanperanmasing-masingsehinggainteraksi yang dihasilkanmerupakanperpaduanantarkebutuhanmasing-masing.

  • Padapolapertukaran yang berlangsung lama dalamsuatustrktur yang kompleksdidukungolehnilai-nilai yang sudahmendarahdaging (internalized), pola-polainidapatdikatakansudahmelembaga (institutionalized). Prosesinstitusionalisasiinisangatpentingdalammempertahankanstrukturpertukaran yang luasdankomplek. Paling tidak, adatigakondisi yang menyebabkanhalitu :

  • Dibuatlanggengantarwaktu.

  • Pola-polapertukaranmenjadikebiasaandanmenjadihistorisdariwaktukewaktu.

  • Nilai-nilaipertukaran yang memberilegitimasitelahtersosialisasi.


Bahan Bacaan utama: pertama,

Thomas S. Ulen, Rational Choice Theory In Law And Economics, Distinguished Professor of Law, College of Law, University of Illinois at Urbana-Champaign and Professor, University of Illinois Institute of Government and Public Affairs, 1999

John Scott, Rational Choice Theory From Understanding Contemporary Society: Theories of The Present, edited by G. Browning, A. Halcli, and F. Webster. (Sage Publications, 2000).

Sukasah Syahdan, Batas-Batas Nasehat Ekonomi, Jurnal Kebebasan: Akal dan KehendakVol. I, Edisi 5, 22 Mei 2007

Nitibaskara, Ronny Rahman

1999 “Catatan Kriminalitas”., Jayabaya University Press

2000 “Kejahatan Berdaulat”, Jakarta Peradaban

2006 “Tegakkan Hukum, Gunakan Hukum”, Jakarta, Kompas Gramedia

2009 “Perangkap Penyimpangan dan Kejahatan”, Jakarta, Yayasan Pengembangan Kajian Ilmu Kepolisian.

Edwir Irfan

Modul Kuliah Kriminologi Fakultas Hukum UNKRIS


ad