1 / 18

Practice Clone 3

Practice Clone 3. Download and get ready!. After opening the sequence…. What questions do you start with? Is the sequence of good quality? Do you see a poly AAA tail? What does that mean? Where is the start of the cDNA insert?. a. b. c. d. e. a. b. c. d. e. c. d. e. b.

ronan-mejia
Download Presentation

Practice Clone 3

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Practice Clone 3 Download and get ready!

  2. After opening the sequence…. What questions do you start with? Is the sequence of good quality? Do you see a poly AAA tail? What does that mean? Where is the start of the cDNA insert?

  3. a. b c d e

  4. a. b c d e

  5. c d e b

  6. What country was this sequence published? A. Russia B. China C. US D. Japan E. France

  7. Blast N: nr/nt Blast N: estremember from other cDNA clones!

  8. BLAST X

  9. BLAST X Note the alignment! Where does our query start to match? What reading frame is the BLAST X in? A. 0 B. +1 C. +2 D. +3 E. at the Met

  10. Looking at the accession number record:

  11. a. b. c d. 1 mmfeyvlflsvylfsigiyglitsrnmvralmclelilnsvninlvtfsdifdsrqlkgd 61 ifsifviaiaaaeaaiglaivssiyrnrkstrinqsnlln n

  12. a. b. c.

  13. Blast P with the ENTIRE ORF

  14. Using the information in the Blast P, what does your protein most likely code for? Cytochrome C NADH dehydrogenase Acetylcholinesterase A transcription factor Both B and C

More Related