Pertemuan 2 kuliah sistem operasi pengertian sistem operasi
Sponsored Links
This presentation is the property of its rightful owner.
1 / 21


  • Uploaded on
  • Presentation posted in: General


Download Presentation


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript

Pertemuan 2 kuliah sistem operasi pengertian sistem operasi


AgusTriwidiyanto, S.T

Tinjauan instruksional



    Mahasiswa mampu untuk menjelaskan Sistem Operasi


    Mahasiswa dapat menjelaskan tentang Pengertian Sistem Operasi



  • PengantarSistemOperasi

  • FungsiDasar

  • Tujuan

  • Sasaran

  • Sejarah

  • Layanan

Pengantar sistem operasi


  • Penghubungantara User dan Hardware

  • Pengelolaseluruhsumber-daya yang terdapatpadasistemkomputer dan menyediakan sekumpulan layanan (system calls) ke pemakai sehingga memudahkan dan menyamankan penggunaan serta pemanfaatan sumber-daya sistem komputer.

System calls

System Calls

  • System call menyediakan interface antara program (program pengguna yang berjalan) danbagian OS.

  • System call menjadijembatanantaraprosesdansistemoperasi.

  • System call ditulisdalambahasa assembly ataubahasatingkatrendah yang dapatmengendalikanmesin

System calls1

System Calls

  • Tigacaramemberikan parameter dari program kesistemoperasi:

    1. Melalui registers (sumberdayadi CPU).

    2. Menyimpan parameter pada data struktur (table) dimemori, danalamat table tsbditunjukoleh pointer yang disimpandi register.

  • 3. Push (store) melalui "stack" padamemoridan OS mengambilnyamelalui pop pada stack tsb.

Fungsi dasar


  • Sistemkomputerpadadasarnyaterdiridariempatkomponenutama, yaitu :

    1. Perangkatkeras (Hardware),

    2. Program aplikasi (Software),

    3. Sistemoperasi (OperatingSystem),

    4. Para pengguna (User).

  • Sistemoperasiberfungsiuntukmengaturdanmengawasipenggunaanperangkatkerasolehberbagai program aplikasisertaparapengguna.

  • Sistemoperasijugaseringdisebutresource allocator

  • Satulagifungsipentingsistemoperasiialahsebagai program pengendali yang bertujuanuntukmenghindarikekeliruan(error) dan penggunaan komputer yang tidak perlu

Cara kerja komputer

Cara KerjaKomputer

Tujuan mempelajari so


  • Merancang & Modifikasi sesuai dengan kebutuhan kita,

  • Memilih alternatif sistem operasi yang dapat memaksimalkan penggunaan sistem operasi

  • Agar konsep dan teknik sistem operasi dapat diterapkan pada aplikasi-aplikasi lain.

Sasaran sistem operasi


  • kenyamanan -- membuatpenggunaankomputermenjadilebihnyaman,

  • efisien -- penggunaansumber-dayasistemkomputersecaraefisien

  • berevolusi -- sistemoperasiharusdibangunsehinggamemungkinkandanmemudahkanpengembangan, pengujiansertapengajuansistem-sistem yang baru.

Sejarah sistem operasi


Komputer Generasi Pertama

Komponen elektronikanya dari Tabung Hampa (Vacuum Tube)

Program dibuat dalam bahasa mesin (Machine Language), yang programnya tersimpan dalam memori komputer. Programnya masih menggunakan bahasa mesin dengan menggunakan kode 0 dan 1 dalam urutan tertentu.


Ukurannya besar dan memerlukan tempat yang sangat luas

Memerlukan banyak Pendingin (AC) karena banyak mengeluarkan panas

Prosesnya relatif lambat

Kapasitas untuk menyimpan data kecil.

Pabrik yang memproduksi :


Contoh mesin :


Sejarah sistem operasi1


Komputer Generasi Kedua

  • Komponen elektronikanya dari Transistor

  • Program dibuat dengan Assembly Language, FORTRAN, ALGOL dan COBOL

  • Sifat-sifatnya:

    • Ukurannya relatif kecil

    • Tidak banyak mengeluarkan panas

    • Telah mengenal Magnetic Tape dan Magnetic Disk untuk menyimpan data

    • Mulai mengenal Tele Processing (time sharing yang memungkinkan beberapa user dapat memakai komputer secara bersama-sama)

    • Proses relatif lebih cepat

    • Kapasitas untuk menyimpan data semakin besar.

Pabrik yang memproduksi:


Contoh mesin :

IBM (IBM 1620, IBM 1401, IBM 7070, IBM 7080, IBM 7094), UNIVAC III, CDC 6600 Super dan CDC 7600, BURROGHS 5500, HONEYWELL 400, PDP 1 & 5

Sejarah sistem operasi2


Komputer Generasi Ketiga

  • Komponen elektronikanya dari Integrated Circuit (IC) yang berbentuk lempengan atau chip

  • Program dibuat dengan bahasa tingkat tinggi (High Level Language), yaitu: BASIC, FORTRAN, COBOL

  • Sudah menerapkan konsep multi processing dan dapat menjalankan program lebih dari satu multi programming dalam waktu yang bersamaan

  • Dapat berkomunikasi dengan peralatan lain untuk melakukan komunikasi data seperti telepon dengan komputer.

  • Sifat-sifatnya:

    • Ukurannya lebih kecil dari komputer generasi kedua

    • Mulai mengenal Multi Programming dan Multi Processing

    • Adanya integrasi antara Software dan Hardware dalam Sistem Operasi

    • Prosesnya sangat cepat

    • Kapasitas untuk menyimpan data lebih besar.

Pabrik yang memproduksi :


Contoh mesin :

IBM S/360, UNIVAC 1108, PDP 8 & 11, HONEYWELL 200, RCA, SPECTRA 70.

Sejarah sistem operasi3


Komputer Generasi Keempat

  • Komponenelektronikanyadariminiaturisasi yang disebut LSI danmulaimemperkenalkan VLSI (Very Large Scale Integration) yang merupakanpaduandari IC dengankapasitasrangkaiandapatmencapai 100.000 komponentiap chip

  • Mulaidikembangkansuatujaringankomputerlokal yang menggunakan ARCNET (Attach Research Computing Network)

  • Program dibuatdenganbahasa: BASIC, FORTRAN, COBOL, PASCAL

  • Sifat-sifatnya:

    • Ukurannyarelatiflebihkecil

    • Sudahmenerapkan Multi Programming dan Multi Processing

    • MengenalDataBase Management System (DBMS).

Pabrik yang memproduksi :


Contoh mesin :


Sejarah sistem operasi4


Komputer Generasi Kelima

Komputergenerasiinimasihdalamtahappengembangandanpemakainyabelumbanyak. PengembangankomputergenarasiinidipeloporiolehnegaraJepang

Komponenelektronikanyamenggunakanbentuk paling barudari chip VLSI

Program dibuatdalambahasa PROLOG (Programming Logic) dan LISP (List Processor)

Komputergenerasikelimadifokuskankepada AI (Artificial Inteligence / KecerdasanBuatan), yaitusesuatu yang berhubungandenganpenggunaankomputeruntukmelaksanakantugas-tugas yang merupakan analog tingkahlakumanusia.

  • Sifat-sifatnya:

    • Dapat membantu menyusun program untuk dirinya sendiri

    • Dapat menerjemahkan dari suatu bahasa ke bahasa lain

    • Dapat membuat pertimbangan-pertimbangan logis

    • Dapat mendengar kalimat perintah yang diucapkan serta melaksanakannya

    • Dapat memilih setumpuk fakta serta menggunakan fakta yang diperlukan

    • Dapat mengolah gambar-gambar dan grafik dengan cara yang sama dengan mengolah kata, misalnya dapat melihat serta mengerti sebuah foto.

Sejarah sistem operasi5


Komputer Masa Depan

Denganteknologikomputer yang adasaatini, agaksulituntukdapatmembayangkanbagaimanakomputermasadepan. Denganteknologi yang adasaatinisajakitaseakansudahdapat “menggenggamdunia”. Dari sisiteknologibeberapailmuankomputermeyakinisuatusaatterciptaapa yang disebutdenganbiochip yang dibuatdaribahan protein sitetis. Robot yang dibuatdenganbahaninikelakakanmenjadimanusiatiruan. Sedangkanteknologi yang sedangdalamtahappenelitiansekaranginiyaitumikrooptikserta input-output audio yang mungkindigunakanolehkomputer yang akandatang. Ahli-ahlisainskomputersekarangjugasedangmencobamerancangkomputer yang tidakmemerlukanpenulisandanpembuatan program olehpengguna. Komputertanpa program (programless computer) inimungkinmembentukciriutamagenerasikomputer yang akandatang

  • Ciri-cirikomputermasadepan

  • lebihcanggihdanlebihmurahdanmemilikikemampuandiantaranyamelihat, mendengar, berbicara, danberpikirsertamampumembuatkesimpulansepertimanusia

  • komputermemilikikecerdasanbuatan yang mendekatikemampuandanprilakumanusia

  • kecerdasanuntukmemprediksisebuahkejadian yang akanterjadi, bisaberkomunikasilangsungdenganmanusia, danbentuknyasemakinkecil.

  • komputermasadepanakanlebihmenakjubkan

Sejarah sistem operasi6


Layanan sistem operasi


  • MenurutTanenbaumharusmemilikilayanansebagaiberikut:

    - Pembuatan program,

    sistemoperasimenyediakanfasilitasdanlayananuntukmembantuparapemrogramuntukmenulis program

    - Eksekusi program,

    instruksi-instruksidan data-data harusdimuatkememoriutamaperangkat-parangkatmasukan/ keluarandanberkasharusdi-inisialisasi, sertasumber-daya yang adaharusdisiapkan, semuaituharusditanganiolehsistemoperasi.

Layanan sistem operasi1


- PengaksesanI/O Device,

SistemOperasiharusmengambilalihsejumlahinstruksi yang rumitdansinyalkendalimenjengkelkan agar pemrogramdapatberfikirsederhanadanperangkat pun dapatberoperasi

- Pengaksesanterkendaliterhadapberkas (File)


Layanan sistem operasi2


- Pengaksesan sistem,

  • padapengaksesandigunakanbersama (shared system). Fungsipengaksesanharusmenyediakanproteksiterhadapsejumlahsumber-dayadan data daripemakaitakterdistorsisertamenyelesaikankonflik-konflikdalamperebutansumber-daya.

    - Deteksi dan Pemberian tanggapan pada kesalahan

  • yaitujikamunculpermasalahanmunculpadasistemkomputermakasistemoperasiharusmemberikantanggapan yang menjelaskankesalahan yang terjadisertadampaknyaterhadapaplikasi yang sedangberjalan.

  • - Akunting.

  • SistemOperasi yang bagusmengumpulkan data statistikpenggunaanberagamsumber-dayadanmemonitor parameter kinerja.



LanjutkePertemuan - 3

  • Login