560 likes | 811 Views
Paggawa ng Epektibong Powerpoint Presentation. Paggawa ng Epektibong Powerpoint Presentation . Clear. Progressive. Simple. Consistent. Summary. Big. Make It Big. Make it Big (Text). This is Arial 12 This is Arial 18 This is Arial 24 This is Arial 32 This is Arial 36
E N D
PaggawangEpektibongPowerpoint Presentation Clear Progressive Simple Consistent Summary Big
Make it Big (Text) • This is Arial 12 • This is Arial 18 • This is Arial 24 • This is Arial 32 • This is Arial 36 • This is Arial 44
Make it Big (Text) Too Small • This is Arial 12 • This is Arial 18 • This is Arial 24 • This is Arial 32 • This is Arial 36 • This is Arial 44
2 m Make It Big (How to Estimate) • Look at it from 2 metres away
Keep It Simple (Text) • Too manycolours • TooManyFontsandStyles • The 6 x 7 rule • No more than 6 lines per slide • No more than 7 words per line
Keep It Simple (Text) • Angmgaproblemangkinakaharapnatingmgakawani, REPS at mgagurong UP ay hindimahihiwalaysamasmalawaknaproblemangkinakaharapngmamamayang Pilipino. • Angmgasuliraninnatinsa UP, ngiba pang mgakawanisagobyerno, ngmgamanggagawasapribadongsektor at ngmgamagsasakahinggilsakabuhayan, satrabaho at karapatan ay maiuugatnatinsapangkalahatangsitwasyonnglipunan. Too detailed !
Keep It Simple (Text) Angmgakinakaharap natingmgaproblema ay: • hindimahihiwalaysamgaproblemangmamamayangPilipino. • Maiuugatitosapangkalahatangsitwasyonngatinglipunan.
SSL 3 Too detailed !
EXECUTIVE CATEGORY 72% - 138% P27,527 - P50,122 PROFESSIONAL LEVEL 45% - 97% SUB-PROFESSIONAL LEVEL 30% - 46% P5,801 - P24,554 Much Simpler P2,851 - P5,229 Salary increase from 2008 to 2012 under SSL3
Keep It Simple (Picture) • Art work may distract your audience • Artistry does not substitute for content
Keep It Simple (Sound) • Sound effects may distract too • Use sound only when necessary
Keep It Simple (Transition) • This transition is annoying, not enhancing • "Appear" and "Disappear" are better
2 m Keep It Simple (Animation) Simple & to the point
WalangAsenso WalangPagbabago MasNaghihirap Lubogsautang SalatnaBenepisyo KawalanngOportunidad MababangSahod Hanap ay Trabaho
Hanap ay Trabaho MababangSahod KawalanngOportunidad SalatnaBenepisyo Lubogsautang MasNaghihirap WalangPagbabago WalangAsenso
Make It Clear (Capitalisation) • ALL CAPITAL LETTERS ARE DIFFICULT TO READ • Upper and lower case letters are easier
Sanserif Z Serif Z Make It Clear (Fonts) clear busy • Serif fonts are difficult to read on screen • Sanserif fonts are clearer
Make It Clear (Fonts) • Italics are difficult to read on screen • Italics are difficult to read on screen • Normal or bold fonts are clearer • Underlines may signify hyperlinks • Instead, use colours to emphasise
Make It Clear (Numbers) Use numbers for lists with sequence For example: Paanoipaglalabanangkarapatan? 1. Malinawan 2. Kumilos 3. Magkaisa
Make It Clear (Bullets) Use bullets to show a list without • Priority • Sequence • Hierarchy, …..
MgaPatakaranngGobyernosaEkonomiya • Liberalization • (pagbubukasngekonomiyasa foreign trade at Investment) • Privatization • (pagbebentangmgapag-aaringgobyernosapribado) • Deregulation • (pag-aalisngkontrolnggobyernosamgaindustriya)
Make It Clear (Colours) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours
low contrast high contrast Make It Clear (Contrast) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours
Make It Clear (Contrast) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours This is light on dark
Make It Clear (Contrast) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours This is dark on light
Make It Clear (Size) • Size implies importance
MgaPangunahingSuliranin 2. AtrasadongEkonomyananakasandigsaagrikultura
Make It Clear (Size) • Size implies importance
Make It Clear (Focal Points) • Focal points direct attention
Make It Clear (Focal Points) • Focal points direct attention
LOANS Sa maskongkreto pang epektoangpribatisasyon, deregulasyon at liberalisasyon ay naglalamanngmgasumusunod: • Pagbabawasnggastusinnggobyernolalunasamgaserbisyongpanlipunan • Patuloyangawtomatikongpagbabayadngdayuhangpautang
In 2006 COMBINED INCOME for the year of the poorest 10.4 million Filipino families. NET WORTH 20 richest Filipinos P801 billion ($15.6 billion) Too many in one go! Arroyo allies, Lucio Tan, Enrique Razon Jr., Eduardo Cojuangco Jr. and Enrique Aboitiz P77,000 per year/family P6,476 per month/family Salary Grade Step1-3 P 6,149 - P6,460 (2008 Before SSL3) Source: Forbes Asia , NSCB, PDI, 2009
In 2006 COMBINED INCOME for the year of the poorest 10.4 million Filipino families. NET WORTH 20 richest Filipinos P801 billion ($15.6 billion) Progressive & thus focused Arroyo allies, LucioTan, Enrique Razon Jr., Eduardo Cojuangco Jr. and Enrique Aboitiz P77,000 per year/family P6,476 per month/family Salary Grade Step1-3 P 6,149 - P6,460 (2008 Before SSL3) Source: Forbes Asia , NSCB, PDI, 2009
KAWANI SG 1 (PhP 9,000.00/buwan) hanggang SG 18 (PhP 31,351.00/buwan) REPS SG 12 (PhP 19,940.00/buwan) hanggang SG 26 (PhP 58,028.00 ) FACULTY SG 14 parasamga Instructor I (PhP 23,044.00) hanggang SG 29 Step 5 parasamga Full Professors (PhP 76,368.00/buwan) Too many & not focused National Wages and Productivity Commission The FLW is defined as the minimum amount needed for a family of six members to meet their daily food and non-food needs plus 10% allocation for savings. = P1,017 X 30 days P 30,510.00/buwan KITA PARA MABUHAY NG MARANGAL
KAWANI SG 1 (PhP 9,000.00/buwan) hanggang SG 18 (PhP 31,351.00/buwan) REPS SG 12 (PhP 19,940.00/buwan) hanggang SG 26 (PhP 58,028.00 ) FACULTY SG 14 parasamga Instructor I (PhP 23,044.00) hanggang SG 29 Step 5 parasamga Full Professors (PhP 76,368.00/buwan) Progressive & thus focused National Wages and Productivity Commission The FLW is defined as the minimum amount needed for a family of six members to meet their daily food and non-food needs plus 10% allocation for savings. = P1,017 X 30 days P 30,510.00/buwan KITA PARA MABUHAY NG MARANGAL
Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract
This tick draws attention Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract
These differences distract! Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract
This implies importance Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract
Confusing differences! Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract
This surprise attracts Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract
These distract! Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract
In Summary • Big • Simple • Clear • Progressive • Consistent