Pendahuluan
Download
1 / 55

PERENC DAN PERANC LINGK BINAAN - PowerPoint PPT Presentation


  • 249 Views
  • Uploaded on

Pendahuluan. DEFINISI PERENCANAAN DAN PERANCANGAN LINGKUNGAN BINAAN.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' PERENC DAN PERANC LINGK BINAAN' - mabyn


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

Pendahuluan

DEFINISI PERENCANAAN DAN PERANCANGAN LINGKUNGAN BINAAN

The man-made surroundings that provide the setting for human activity, ranging in scale from personal shelter to neighborhoods to the large-scale civic surroundings.interdisciplinary field of study which addresses the design, management and use of these man-made surroundings and their relationship to the human activities which take place within them. The field is generally not regarded as an academic discipline in its own right, but as a "field of application" (or "interdiscipline") which draws upon the individual disciplines of economics, law, management, design and technology in sustainable sense.

PERENC DAN PERANC LINGK BINAAN

SURJONO, PWK UB


Perencanaan Wilayah & Kota sbgAlatPenataan Kota

Perkemb dg Intervensi

Perkemb tanpa intervensi

Perkemb yang ada

  • Perlu Upaya Pengembangan Kota

  • Penataan Ruang

  • Action Program

  • Rekayasa Wilayah

MASA LALU

SAAT INI

MASA DEPAN

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


  • FungsiRencana

    • SebagaiInstrumenPendorong, Pemacu Pembangunan

      • Lokasi Pembangunan SaranaBaru (GOR, Perdag, Terminal), Peningkatan & Pembangunan Jalan

    • SebagaiInstrumenPembatasan, Konservasi

      • Taman, SempadanJalan, Sempadan Sungai, KawasanKonservasi

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


PENGERTIAN

  • WOLF, 1994

    • PERENCANAAN adalahPengembanganataupenyusunan FORMULASI suatu VISI dari KONDISI yang LEBIH diinginkanbagimasyarakatdimasaDepan

    • RENCANAadalahEkspresidari VISI diatas, yang memperlihatkanStruktur Tata Ruang, Tata GunaLahan & InstrumenTindakanuntukmewujudkannya.

    • IlmuPerencanaanberkaitandenganProsesPerubahan, ygsecarakhususmengarahkankegiatanmanusiadanjugalingkungannya

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


  • Taylor, 1998

    • PERENCANAAN secaraumumadalah

      • Aktivitas yang didasarkan pada tujuan (bukan rutin dan reaksi yang sederhana)

      • Persiapan bagi masa depan, baik menyusun tindakan tunggal yang telah disiapkan maupun alternatif tindakan untuk mengantisipasi tujuan yang telah diputuskan

    • PERENCANAAN secara Institusional

      • Mempersiapkan keputusan Politik (decision making vs. decision taking)

      • Mengendalikan proses perkembangan wilayah & Kota

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Pengertian
PENGERTIAN

  • D. Laepple

    • PERENCANAAN adalah

      • ProsesmeningkatkanRasionalitasdalamProsesPengambilanKeputusandanPengendalian,

      • PenggunaanMetode yang RasaionaluntukmemformulasikanVisimasyarakatdanPenerapannyadalam PROGRAM Tindakan yang konkret

  • Claus Heidemann, 1993

    • PERENCANAAN adalahProsespenyusunankumpulanpedomansebagaiarahantindakan yang diinginkan

    • RENCANA adalahkumpulanpedomansebagaiarahantindakan yang diinginkan


Pengertian1
PENGERTIAN

  • PENGERTIAN

    • RENCANA

      • kumpulanpedoman

      • sebagaiarahantindakan yang diinginkan

    • PERENCANAAN

      • Prosespenyusunankumpulanpedoman

      • sebagaiarahantindakan yang diinginkan

  • DUA LEVEL dalam PERENCANAAN

    • Kumpulan PEDOMAN bersifat KONSEPSUAL

    • TINDAKAN bersifat OPERASIONAL


Pengertian2

Level Konsepsual

PEDOMAN

PLANNING WORLD

LIFE WORLD

Level Operasioanl

PENGERTIAN

  • Dua Level dalam PERENCANAAN

TINDAKAN


Pengertian3

PLANNING WORLD

LIFE WORLD

PENGERTIAN

  • PROSES DASAR PERENCANAAN

Proses

Input

Output

Setting

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Pengertian4
PENGERTIAN

  • TITIK KRITIS dalam PERENCANAAN

    • Adanya 2 Level yang Berbeda

    • PenggunabukansebagaiPenyusun

    • Melibatkanbanyak Stakeholders

      • Multi masalah

      • Multi tujuan

      • Multi metode (disiplin)

STRATEGInya


Pengertian5

PERENCANAAN

SETTING

PENGERTIAN

  • Didukung ILMU PENGETAHUAN

  • Dikendalikan REASONING (masukakal)

  • Diarahkan TUJUAN

  • Terikat HUKUM & PERATURAN

Tindakan


Pengertian6
PENGERTIAN

  • PERENC. didukung ILMU PENGETAHUAN

    • ProsesdalamPerencanaanmerupakanProses ILMIAH

    • Mengamati FENOMENA

      • Metode Survey

    • Memahami FENOMENA

      • MetodeAnalisisDeskriptif

      • MetodeAnalisisEvaluatif (Korelasional, KausalKomparatif)

    • Mengantisipasi FENOMENA

      • Metode Development, Action Research

    • Mengendalikan FENOMENA

      • Metode Monitoring, Management

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Pengertian7
PENGERTIAN

  • PERENCANAAN dikendalikan REASONING

    • Sebagaipedoman TINDAKAN, perencanaanharusmemilikijustifikasi yang tepatdankuat

    • Perencanaanmelibatkanbanyak Stakeholders (multy stakeholders)  Prosesnyaharusdapatdipahamiolehbanyakpihak

  • PERENCANAAN diarahkan TUJUAN

    • PerencanaanberkaitandenganTindakanpadamasadepan harusmemilikitujuan yang jelas yang mendasaritindakan yang diambil

  • PERENCANAAN terikat HUKUM/ PERATURAN

    • Perencanaanberadapada domain Publik diperlukanaturanjelas yang mengikatsegalahal yang telahdisepakati


Pengertian8

INSTITUSIONAL

PROFESIONAL

METODIK

TEMATIK

PENGERTIAN

  • FUNGSI MEDIASI RENCANA

Kepentingan politis

planning

Kemampuan administratif

Pertimbangan teoritis

planning

Operasional praktis

Kondisi saat ini

planning

Konsepsi masa depan

Temuan

planning

Usulan tindakan

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Pengertian9
PENGERTIAN

  • UNSUR PERENCANAAN

    • Informasi

      • Input suatuprosespengolahan/ analisis yang berbentuk data empiris yang bermakna

    • Transformasi

      • Prosesperubahan yang sistematisdariinformasiempirismenjadirencana

    • Pedoman/Instruksi

      • Hasilsuatutransformasi yang berbentukpedomanatauinstruksi (rencana)


Pengertian10

INFORMASI

PEDOMAN/

INSTRUKSI

TRANSFORMASI

Perenc.dg. SPEKULASI

Perenc.dg. INTUISI

PERENCANAAN

Perenc.dg. INSPIRASI

ANALISIS

STATISTIK

MODELISTIK

‘NGRUMPI’

PENGERTIAN

  • Kategorisasi PERENC. berdasarkan UNSUR PERENCANAAN


Siklus dalam perencanaan

Symbolic Level

Material Level

SiklusdalamPerencanaan

  • SIKLUS EPISTEMIK

Beliefs

Experience

Expectation

Situation

PENGALAMAN yang didapat dari SITUASI, berakibat perubahan thd PEMAHAMAN. PEMAHAMAN ini digunakan sebagai dasar PENGHARAPAN/PERKIRAAN pada saat menghadapi SITUASI


Siklus dalam perencanaan1

Symbolic Level

Material Level

SiklusdalamPerencanaan

  • SIKLUS PRAGMATIK

Intents

Outcome

Action

Situation

TINDAKAN yang didasarkan atas TUJUAN, diterapkan pada saat menghadapi SITUASI untuk mendapatkan HASIL yang DIINGINKAN


Siklus dalam perencanaan2

Symbolic Level

Material Level

SiklusdalamPerencanaan

  • SIKLUS PERENCANAAN

Beliefs

Intents

Experience

Instruction

Outcome

Action

Situation

TINDAKAN yang didasarkan atas TUJUAN, diformulasikan untuk mengantisipasi PEMAHAMAN berdasar PENGALAMAN thd proses TINDAKAN-SITUASI-OUTCOME/HASIL; dan kemudian ditransforma-sikan kedalam INSTRUKSI/PEDOMAN untuk melakukan TINDAKAN

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Siklus dalam perencanaan3

Symbolic Level

Material Level

SiklusdalamPerencanaan

  • SIKLUS PERENC.DG SELEKSI INTERNAL

TUJUAN yang mendasari formulasi INSTRUKSI selalu merujuk hanya pada satu SITUASI/SETTING yang dipresentasikan pada PEMAHAMAN. Sedangkan TINDAKAN selalu mendapatkan OUTCOMES yang beragam di luar PEMAHAMAN awal. Oleh sebab itu diperlukan SIKLUS RANCANGAN dan PENILAIAN

Beliefs

Intents

Concepts

Experience

Evaluation

Instruction

Outcome

Action

Situation


Siklus dalam Perencanaan

Life World

Planning World

Penyusunan

Rencana

Scanning

Rencana

Hasil/Outcome

Setting

Intervensi

  • PROSES PERENCANAAN

  • Rancangan/ Alternatif

  • Penilaian

  • Tahapan

  • Peran Stackholders

  • Sumber Daya

  • Skedul

  • Eksplorasi

  • Interpretasi

  • Fisik Ekologis

  • Sosial

  • Ekonomi

  • Institusi

  • Informasi

  • Motivasi

  • Organisasi

  • Instalasi

  • Preservasi

  • Modifikasi


Siklus eksplorasi interpretasi

REPRESENTASI

PENJELASAN

SiklusEksplorasi-Interpretasi

INTERPRETASI

Decoding

DATA

REFLEKSI

Pengukuran

Penilaian

OBSERVASI

JEJAK

Perekaman

Askripsi

KEJADIAN

Scanning

EKSPLORASI

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Siklus rancangan penilaian

PENYELESAIAN

PEMERIKSAAN

Siklus Rancangan - Penilaian

PENILAIAN

Antisipasi

HASIL

PENILAIAN

Peroleh

Pertimbangkan

PENGEMBANGAN

TINDAKAN

Formulasi

Refleksikan

TUJUAN

Uraian

RANCANGAN



Theosentrisme
THEOSENTRISME

  • MerupakanFaham

    • yang melahirkanPemerintahanTheokrasi, yang Menggabungkan Dogma Agama dg Kekuasaan

    • Yang menggeserfahamPoliteismeolehMonoteisme

      • Mitos-mitosdigeseroleh dogma agama

  • Bentukmasyarakatberkembangkearahkehidupanygdiatur & diperintaholeh Raja melaluisistemygbersifatmiliterdidampingiahli agama, pendetaataurohaniawan

  • PengaruhthdPerencanaan: muncul AUTHORITARIAN PLANNING


Theosentrisme1
THEOSENTRISME

  • AUTHORITARIAN PLANNING

    • Perencanaankotaygmendukung/ menerjemahkanbentukkekuasaan Authoritarian (monarkiabsolutdanpenguasa agama)

    • Mengesampingkankepentinganpasar, masyarakat

    • Ciri AUTHORITARIAN PLANNING

      • BentukkotamengikutiPerencGeometrik

      • Terdapatjalanpanjang & lurus

      • Fasade bang disepanjangjalancenderungseragam

      • Terdapat plaza terbukadidepan bang monumental


Theosentrisme2

Kota Karlsruhe Jerman

THEOSENTRISME

  • Blok permukiman dibuat dg mengikuti bentuk empat persegi panjang

  • Terdapat boulevard dan taman-taman yg sangat luas

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Theosentrisme3
THEOSENTRISME

  • Karlruhe

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


THEOSENTRISME

  • Bagaimanadi Indonesia?

    • Munculpadaabad VII atau VIII

    • Raja dianggapsebagaiperantaraantararakyat & Tuhan

    • Berkembanghinggajaman Hindu dan Islam

    • Contoh yang jelas: kota Jogjakarta & Surakarta denganpenggunaankonsep “PanotogomoKalifatullah”

      • Adanyaalun-alun

      • BangunanMasjidberadadisekitaralun-alun


Theosentrisme4
THEOSENTRISME

  • Kota Jogja

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006



Theosentrisme5
THEOSENTRISME

  • Malioboro dan Tugu, Jogja


Theosentrisme6
THEOSENTRISME

  • Alun-alun dan Masjid Kota Bandung

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Utopianisme
UTOPIANISME

  • DalamlingkupPerencanaandapatdiartikan “no where land” ataukhayalanatauimpian

  • DalambudayaJawa, terdapat slogan:

    • Gemahripahlohjinawi

    • Tata tititentremkartoraharjo

    • Adilporomarto

  • Saatini?

    • JogjaBerhatiNyaman

    • Solo Berseri

    • Malang Kota Bunga

  • AkarFilosofi Utopia

    • Humanisme (melahirkan Social Utopia) danNaturalisme (melahirkan Physical Utopia)


UTOPIANISME

  • SOCIAL UTOPIA

    • Hipotesa: manusia akan lebih baik, lebih bahagia, lebih produktif, lebih religius apabila tatatan atau lembaga- lembaga kemasyarakatan diubah

    • Tokohnya: Plato

  • PHYSICAL UTOPIA

    • Hipotesa: manusia akan lebih baik, lebih sehat, lebih puas apabila lingkungan fisik ditata secara serasi

    • Bapak dari “Physical Utopia”:

      Thomas More (abad 16, yg

      terkenal dg konsep

      “rotasi kehidupan

      desa kota”

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


UTOPIANISME

  • Tokoh Lain Physical Utopia

    • Robert Owen (1824) dengankonsep “A New View of Sciety

    • Le Corbusier (abad 20) dg Proposisinya “A city made for speed is made for success”

      • Kota sebagaimesin

      • Kota sebagaikonsentrasipendudk

    • Franks Lloyd Wright (abad 20)

      • Konsepnya “Broadacre City” atau Kota skalabesar


UTOPIANISME

  • Karya Le Corbusier

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


Utopianisme1
UTOPIANISME

  • Karya Le Corbusier



Utopianisme3
UTOPIANISME

  • Kritikthd UTOPIANISME

    • Utopia hanyamemerincikeadaandimasadepan, tapitidakmemerincibagaimanacaramenciptakankeadaantsb

    • KritikinimelahirkankonsepPerencanaanLingkungan Kota

  • PengaruhthdPerencanaan: ROMANTIC PLANNING:

    • Mengembangkannilai-nilaiesensikemanusiananygtelahterabaikanolehsistemindustridanbirokrasi

    • Nilai-nilaikemanusiaaninidikembalikanataudikaitkankembali dg lingkperdesaan, dimanaudarabersih, open space dg pohon-pohonmenjadiperhatian/penekananperenc.lingkbinaan



Utopianisme4
UTOPIANISME

  • Konsep Garden City oleh Ebenezer Howard


UTOPIANISME

  • Bagaimanadi Indonesia?

    • Bersamaandengandatangnya era kolonialisme

    • Di Eropa: sebagaireaksiatasdampaknegatifrevolusiindustri

    • Di Indonesia: hanyasebagai “copy” dariEropa

    • Contoh

      • Jogja: Kawasan Kota Baru

      • Bandung: Kawasan Dago

      • Semarang: KawasanCandiBaru

      • Malang: KawasanJalanGunung-gunung

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006


UTOPIANISME

  • Alun-alunBunder Kota Malang


Positivisme
POSITIVISME

  • Abad ke 19 diyakinisebagaiabadpembangunan modern, ygjugadikenalsebagaiabadPositivisme

  • Pembangunan dankemajuanditandaiolehdominasiIlmuPengetahuan modern danilmupositif.

  • BapakPositivisme: August Comte (1798-1857), karenaaliranfilfasatygdihasilkandisebutsbgPositivisme

  • MaknaPositivismebagi Comte:

    • Nyata, tidakkhayal, menolakmetafisikadanteologik, bermanfaat & diarahkanpadapencapaiankemajuan, pasti, jelas & tepatsertamenujukearahpenataan & penertiban

Sumber: Wicaksono, AD. Pelatihan Perencanaaan Kota dan Wilayah, 2006



POSITIVISME

  • Makna Pembangunan bagi Comte

    • Suatugerakpositif, yaitusuatugerakmenujukearahtingkatyglebihmajudanlebihtinggi, ygdikendalikanataudidominasiolehcendekiawandanindustrialis

  • PengaruhthdPerencanaanadalahbahwaPerencanaan:

    • Harusmemilikikapasitasreformasisosial (mengubahtatanansosial)

    • Harusmemilikicitrapasti

    • Merupkancetakbiru (blue print) drsuatubadanperencanaanygberisiperumusan-perumusan program utkmencapaitujuanygtelahditetapkan


Positivisme2
POSITIVISME

  • Program-program pastidilaksanakandilapangantanpaperubahan

  • Mengarahkpdpekerjaanketeknikan (engineering) & penerapanstandarteknis dg pendekatan master plan

  • Bagaimanadi Indonesia?

    • Munculpadasaat Indonesia mulaimembangunkotanyasendiri

    • Padath 1950-1970

      • positivismemenjadipenggerakdalampembangunanhargadiribangsa (nation nuilding)

      • Kota di Indonesia (khususnya Jakarta) dibangun dg bangunanpencakarlangitdanmegaproyek (Monas, HI, Sarinah) utkmembuatsejajar dg kotabesardidunia


  • Positivisme3
    POSITIVISME

    • PadaTahun 1970-1980

      • PengaruhPositivismeberlanjutseiiringdengan oil boom

      • Banyakmegaproyekdibangun dg pendekatan “positive planning” (blueprint oriented).

      • Pusatkotabergeserdaripusatpemerintahan, sosialbudaya (Civic centre) menjadipusatpertumbuhanekonomi

      • Munculpusat-pusatekonomibaru

        • CBD (Central Business District) baru

        • PusatIndustribaru (PulauGadung Jakarta, Palur Solo, SIER Surabaya)

      • Pembang. Kota identik dg pekerjaanke-PU-an


    Positivisme4
    POSITIVISME

    • Jakarta


    Rasionalisme
    RASIONALISME

    • AliranFilsafatygdidasarkan pd kekuatan RASIO atau AKAL BUDI

    • SumberPengetahuan yang dapatdipercayaadalahakalataurasio

      • Pengalamanempirishanyaberfungsimeneguhkanpengetahuan yang diperoleholehakal

      • Segalahalyginderawi (sensual) disikapisecararagu-ragu, karenaiatidakpasti, relatif, berubah-ubah, danmenyesatkan

    • Metodekerja yang dipakaiolehkaumrasionalisadalah DEDUKTIF


    Rasionalisme1

    Descrates

    Pascal

    K.Raymond Popper

    RASIONALISME

    • TokohRasionalisme

      • Rene Descrates (1596-1650)

      • Blaise Pascal (1623-1662)

      • Spinoza (1632-1677)

      • Karl Raymond Popper (1902-1994)


    ad