Supplemental material 1
This presentation is the property of its rightful owner.
Sponsored Links
1 / 4

1 60 PowerPoint PPT Presentation


  • 92 Views
  • Uploaded on
  • Presentation posted in: General

Download Presentation

1 60

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


1 60

Supplemental material 1.Spraying with ethephon produces an ethylene physiological response. One-month-old seedlings were sprayed with different concentrations of ethephon, without (A) or with (B) a previous application of different concentrations of AgNO3. After each application, the Magenta boxes were hermetically closed and the leaf abscission was evaluated after an 8-day period.


1 60

PR1

1 60

Capsicum chinenseTGLFNISLLL .VSLMILAIF HSCDAQNSPQ DYLEVHNNAR AQVGVGPMTW DAGLASRAQN

SolanumtuberosumMGLFNISLLL .TCLMVLAIF HSCDAQNSPQ DYLAVHNDAR AQVGVGPMSW DAGLASRAQN

SolanumphurejaMGLFNISLLL .TCLMILAIF HSCDAQNSPQ DYLAVHNDAR AQVGVGPMSW DAGLASRAQN

Capsicum annuum MGLFNIPLLL .VCLIVLAIF HSCHAQNSPQ DYLAVHNNAR AQVGVGPMSW DAGLASRAQN

SolanumlycopersicumMGLFNMSLLLMTCLMVLAIF HSCDAQNSPQ DYLEVHNDAR AQVGVGPMSW DADLESRAQS

61 120

Capsicum chinense YANSRTGDCN LIHSGPGENL AKGGGDFTGR AAVELWVFEK PNYNHGTNQC ASGKVCGHYT

SolanumtuberosumYANSRTGDCN LIHSGAGENL AKGTGDFTGR AAVQLWVGEK PNYNYGTNQC ASGQVCGHYT

SolanumphurejaYANSRTGDCN LIHSGAGENL AKGSGDFTGRAAVQLWVGEKPNYNYGTNQC ASGQVCGHYT

Capsicum annuum YANSRTGDCN LIHSGAGENL AKGGGDYTGRRAVELWVSEK PNYNHATNQCAGGE.CRHYT

SolanumlycopersicumYANSRAGDCN LIHSGSGENL AKGGGDFTGR AAVELWVSEK PNYNYDTNECVSGKMCGHYT

121 162

Capsicum chinense QVVWRNSVRL GCGRARCNNG WWFISCNYDP VGNWAGQSPL LK

SolanumtuberosumQVVWRNSVRL GCGRARCNNG WWFISCNYDP VGNWVGQRPY

SolanumphurejaQVVWRNSVRL GCGRARCNNG WWFISCNYDP VGNYVGQRPY

Capsicum annuum QVVWRNSVRL GCGRARCNNG WWFISCNYDP VGNWVGQRPY

SolanumlycopersicumQVVWRDSVRL GCGRALCNDG WWFISCNYDP VGNWVGQRPY

Supplemental material 2. The deduced amino acid sequence of Habanero pepper PR1cDNA was aligned to their corresponding orthologues in Solanumtuberosum(GenBank accession code AY050221), Solanumphureja(GenBank accession code AJ493450), Capsicum annuum (GenBank accession code AY829644), and Solanumlycopersicum(GenBank accession code AJ001627).


1 60

PR10

1 60

Capsicum chinenseMGAYTFTNES TVPVAPSRLF KALVIDFNHI VCKLMP.DVE SIENIEGDGG AGTIKKVTFV

Capsicum annuumMGAYTFTDKS TASVAPSRLF KALVIDFNNLVSKLAP.DVKSIENVEGDGG AGTIKKMTFV

Capsicum baccatumMGAYTFTDKS TASVAPSRLF KALVIDFNNI VSKLAP.DVKSIENVEGDGG AGTIKKMTFV

SolanumvirginianumMGVNTYTHESTTSISPSRLF KALVLHFDNLVPQVVPHEVKNIETIEGDGG AGSIKQMNFV

SolanumlycopersicumMGVTTYTHEDTSTVSPNRLF KALVIDGDNL IPKLMP.NVKNVET.EGDG. ..SIKKINFV

61 120

Capsicum chinense EGGPMKYLRH KIHVIDEENL VTKYSLIEGD ALANKADSVD YDVKFEASAD GGCVGTTVTV

Capsicum annuum EGGPIKYMKH KIHVIDEKNL VTKYSLIESDVTENKAESVD YDGKFEASAD GGSVCTTVTV

Capsicum baccatumEGGPIKYMKH KIHVIDEKNL VTKYSLIESDVLEGKAESVD YDGKFEASAD GGCVCTTVTV

SolanumvirginianumEGGPIKYLKH KIHVIDDKNLETKYSLIEGDVLGDKLESINYDIKFEASGD GGCVCKTTTE

SolanumlycopersicumEGGPIKYLKH KIHAIDDKNL VTKYSLIEGDVLGDKLESITHDVKFEPAGNGGCVCKTKTE

121 160

Capsicum chinense YNTIGDYVVT EEEHNLHKAR FDAIVTAVVT YLLTNPSAYA

Capsicum annuum YNTKGDYVVT EEEHNVHKEKANDLLKAIEAYLLANPSVYV

Capsicum baccatumYNTKGDYVVT EEEHNVHKDKANDLLKAIEAYLLANPSVCV

SolanumvirginianumYHTKGDHVIT EEEDNVGKDKAINLFKAVEAHLLANPSVYA

SolanumlycopersicumYHTKGDYVLKDEEHNEGKKHAMELFKAVEDYLLANPSIYA

Supplemental material 3.The deduced amino acid sequence of Habanero pepper PR10cDNA was aligned to their corresponding orthologues in Capsicum annuum (GenBank accession code AF244121), Capsicum baccatum(GenBank accession code DQ351934), Solanumvirginianum(GenBank accession code AY660753), and Solanumlycopersicum(GenBank accession code AB211525).


1 60

Esterase

1 60

Capsicum chinenseMDGLYWIKST QDEWVRKYSD LSNVYLFGSS CGGNIAYHAG LRVAAGAYKE LEPVKIKGLI

Capsicum annuumMDGLYWIKST QDEWVRKYSD LSNVYLFGSS CGGNIAYHAG LRVAAGAYKE LEPVKIKGLI

ActinidiaargutaVDALHWIRTS DDEWLRDFAD LSNCFLMGSS AGGNIAYHAG LRAAAAV.DD LAPLKIQGMV

Medicago truncatulaMEALSLIRSS QDEWLTKYVD YSKCYLMGNS AGATIAYHAG LRVLEKV.ND FEPLKIQGLI

61 120

Capsicum chinenseLHQPYFSGKN RTESEEKLKD DQLLPLHAID KMFDLSLPKG TLDHDHEYSN PFLNGG.SKH

Capsicum annuumLHQPYFSGKN RTESEEKLKD DQLLPLHAID KMFDLSLPKG TLDHDHEYSN PFLNGG.SKH

ActinidiaargutaLHQPYFGGSD RTPSEMRSVD DPLLPLFVNHLMWELSLPIG .ADRDHEYCN LTVSSE.SES

Medicago truncatulaLRQPFFGGTN RTESELRLEN DPNFPLCVSD LCWDLALPIG .VDRNHEYCN PTVGNDVDEK

121 180

Capsicum chinenseLDDVIAQGWK ILVTGVSGDP LVDNARNFAN FMEEKGIKTF KLFGD.GYHA IEGFEPSKAA

Capsicum annuumLDDVIAQGWK ILVTGVSGDP LVDNARNFAN FMEEKGIKTF KLFGD.GYHA IEGFEPSKAA

ActinidiaargutaIETFKLLGWK VIVTGCDGDP LIDRQMELVKVLEKKGVRTIALFDEGGFHGVEFRDPTRMK

Medicago truncatulaLDKIKDQGWR VLVSINGGDLLADRAKELVQ LMDEKGVEVVKDFQEEGFHGVEFFEPSKAK

181 195

Capsicum chinenseALIGAPKDFICATTN

Capsicum annuumALIGATKDFICATTN

ActinidiaargutaAFLEFLIPCL N....

Medicago truncatulaKFIKLVKGFISTFDA

Supplemental material 4.The deduced amino acid sequence of Habanero pepper esterase cDNA was aligned to their corresponding orthologues in Caspicum annuum (GenBank accession code AF072533), Actinidiaarguta(GenBank accession code DQ279915), and Medicagotruncatula(GenBank accession code BT052596).


  • Login