Etude de l volution et de la structure des g nomes des vert br s
This presentation is the property of its rightful owner.
Sponsored Links
1 / 31

Etude de l'évolution et de la structure des génomes des vertébrés PowerPoint PPT Presentation


  • 93 Views
  • Uploaded on
  • Presentation posted in: General

Etude de l'évolution et de la structure des génomes des vertébrés. Plan. Introduction Évolution et structure des génomes Première étape: Comparaison des génomes Processus Automatisation (CASSIOPE) Un exemple: La région du CMH Hypothèse Résultats Une premier pas vers la reconstruction

Download Presentation

Etude de l'évolution et de la structure des génomes des vertébrés

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Etude de l volution et de la structure des g nomes des vert br s

Etude de l'évolution et de la structure des génomes des vertébrés


Etude de l volution et de la structure des g nomes des vert br s

Plan

Introduction

Évolution et structure des génomes

Première étape: Comparaison des génomes

Processus

Automatisation (CASSIOPE)

Un exemple: La région du CMH

Hypothèse

Résultats

Une premier pas vers la reconstruction

Futur


But etude de l volution et de la structure du g nome des vert br s

But: Etude de l'évolution et de la structure du génome des vertébrés

  • Reconstruire l’histoire des génomes

  • Mettre en évidence les différents événements chromosomiques (Polyploïdisation / Duplication « en bloc » - Remaniements chromosomiques: inversion, translocation, ...)

  • Reconstruire les génomes ancestraux et actuels non séquencés


Comparaison de g nomes

Comparaison de génomes

Reconstruction => Première étape indispensable

Comparer


Comparaison de g nomes1

Comparaison de génomes

Reconstruction => Première étape indispensable

Comparer

Rechercher les régions conservées

  • Conservation par descendance

  • Conservation par convergence

    Utiliser le plus grand nombre de génomes possible


Recherche de r gions conserv es

Recherche de régions conservées

  • 1 région de départ

  • Recherche des orthologues

  • Localisation de ces orthologues

  • « Clusterisation »

  • Test statistique pour la conservation

  • « Retour » sur la région conservée trouvée


Recherche de r gions conserv es1

Recherche de régions conservées

Grand nombre de données à manipuler

=>

Automatisation: développement d'un outil informatique CASSIOPE

(Clever Agent System Inheritance and Other Phenomena in Evolution)


Etude de l volution et de la structure des g nomes des vert br s

Data from

Web databases

C.A.S.S.I.O.P.E

Clever Agent System for Synteny Inheritance and Other Phenomena in Evolution

Ensembl by ENSJ API

Sequences +

Localization +

QTL, ...

NCBI by Entrez Utilities

JADE

multi-agents framework

Phylogeny Tasks

RMI

OMIM

diseases

ACL/SL

ACL/SL

ACL/SL

PhyloGenomics

Ontology

Questions

in SL language

Expert

System

Orthologs

Detection

ACL/SL

ACL/SL

Ontology

Persistance

JENA library API

BEAN

generator

plugin

Protégé

GUI

POSTGRESQL

RDBMS

OWL


Etude de l volution et de la structure des g nomes des vert br s

Agent

Ensembl

Recherche

le contenu

en génes


Etude de l volution et de la structure des g nomes des vert br s

FIGENIX

Agent

Ensembl

Recherche

le contenu

en génes


Etude de l volution et de la structure des g nomes des vert br s

FIGENIX

Agent

Ensembl

Recherche

le contenu

en génes

Ensembl

Localisation


Etude de l volution et de la structure des g nomes des vert br s

FIGENIX

Agent

Ensembl

Recherche

le contenu

en génes

Ensembl

Localisation


Etude de l volution et de la structure des g nomes des vert br s

FIGENIX

Agent

Ensembl

Recherche

le contenu

en génes

Ensembl

Localisation

Même espèce

Même chromosome

Nbre gènes ≥ 3

< 300 000 pbs


Etude de l volution et de la structure des g nomes des vert br s

FIGENIX

Agent

Ensembl

Recherche

le contenu

en gènes

Ensembl

Localisation

Agent

Ensembl

Recherche

le contenu

en gènes

Test

statistique

Même espèce

Même chromosome

Nbre gènes  3

< 300 000 pbs


Etude de l volution et de la structure des g nomes des vert br s

Région très conservée

Si score  0.001

Région conservée

Si 0.05  score  0.001

Si score  0.001

Région non conservée


Etude de l volution et de la structure des g nomes des vert br s

#############################################################

Value P: 2.499553651133726E-4

Value K: 1.0

Value N: 19

################ synteny higthly conserved ##################

Tree of life: cassiope1

score: 1.0653464368903798E-5

%%%%%%%%%%%%%%%%%%%%%%%%%% Question %%%%%%%%%%%%%%%%%%%%%%%%%

UID Cluster: a20892:10412f43264:-7fcb

Species:

Name: HOMO~SAPIENS

TaxeId: 9606

Genes list:

>lcl|ENSG00000126878 |9606|HOMO~SAPIENS|C9orf58|

>lcl|ENSG00000197355 |9606|HOMO~SAPIENS|NP_997192.1

%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%

ortholog number: 3

UID Cluster: a20892:10412f43264:-5614

Species:

Name: TETRAODON~NIGROVIRIDIS

TaxeId: 99883

Location:

Chromosome: 4

Genes list:

7

%%%%%Gene:

a20892:10412f43264:-7916

Ortholog: TRUE

Reference:

Identifier: GSTENG00014392001

Source URI: http://ensembldb.ensembl.org

Name: GSTENG00014392001

Location:

Chromosome: 4

Band:

Start: 3111322

End: 3142151

Strand: -1

Protein:

Header: >lcl|GSTENG00014392001 |99883|TETRAODON~NIGROVIRIDIS|_

Data: ENPYLCSDECDASNPDLAHPPQLMQDRERNGLITYWQTVTWRRHPEPLLA

Synteny Vista


Utilisation de cassiope sur une r gion sp cifique

Utilisation de CASSIOPE sur une région spécifique


2 tours de polyplo disation chez le g nome des vert br s

2 tours de polyploïdisation chez le génome des vertébrés


Analyse d une r gion les r gions de paralogie du cmh

Analyse d’une région : les régions de paralogie du CMH

Existe-t-il pour une région donnée chez Amphioxius, 4 régions de paralogie chez les vertébrés

évènement de duplication

évènement de spéciation

?

?

?

?

?

?

?

?


Mat riel et m thode

Matériel et Méthode

Génomes séquencés des vertébrés:

H. sapiens (homme), C. Familiaris (chien), G. Gallus (poulet) , T. Nigroviridis (poisson ballon)

Région amphioxius choisie correspondant aux 4 régions de paralogie du CMH de H. sapiens

CASSIOPE


R gion conserv e

Région conservée

4 régions de paralogie existantes chez différents vertébrés

Région conservée


4 r gions de paralogie conserv es chez les diff rents vert br s

4 régions de paralogie conservées chez les différents vertébrés

Région chromosome 9 H. sapiensrégion chromosome 17 G. gallus : région du chromosome 9 C. familiaris

Région chromosome 6 H. sapiensrégion chromosome 16 G. gallus région du chromosome 12 C. familiaris

Région chromosome 1 H. sapiensrégion chromosome 8 G. gallus région du chromosome 6 C. familiaris

Région chromosome 19 H. sapiensrégion chromosome 28 G. gallus : Région chromosome 20 C. familiaris


Duplication confirm e

évènement de duplication

évènement de spéciation

Duplication confirmée

  • Il existe pour une région donnée chez Amphioxius, 4 régions de paralogie chez les vertébrés


Vers la reconstruction des g nomes ancestraux

Vers la reconstruction des génomes ancestraux


Reconstruction des g nomes ancestraux

Reconstruction des génomes ancestraux


Reconstruction des g nomes ancestraux1

Reconstruction des génomes ancestraux


Reconstruction des g nomes ancestraux2

Reconstruction des génomes ancestraux

Utiliser CASSIOPE sur les génomes en entier

Utiliser des nouveaux génomes informatifs

Définitions des concepts biologiques pour la reconstruction

Modélisation mathématique (collaboration avec E. Pardoux et S. Grusea)

Maximum de vraisemblance

Création d'algorithmes

Automatisation => CASSIOPE


Pr diction des g nomes actuels

Prédiction des génomes actuels

Évaluer la qualité des algorithmes

Ancêtre

Ancêtre

H. sapeins

S. scrofa

G. gallus

T. nigroviridis

Génome reconstruit

Génome séquencé


Etude de l volution et de la structure des g nomes des vert br s

Laboratoire Evolution Biologique

www.up.univ-mrs.fr/evol

Virginie Lopez Rascol [email protected]

Pierre Pontarotti

Phillipe Gouret

Etienne G.J. Danchin

LATP

Simona Grusea

Etienne Pardoux


Retomb es directes au niveau bio m dical

Retombées directes au niveau bio médical

Recherche des gènes impliqués dans des QTL ou maladies génétiques

Mh1

Mp1

Reconstruction de la région

chez l' espèce p par CASSIOPE

Mp1

Mc1

Mh2

QTL?

Mg1

Mp2

Mc2

Mp2

Espèces séquencées

+ informations fonctionnelles

(GO)

Espèce p

non séquencée

Mg2

Relations entre la fonction putative des gènes de la région

et le phénotype

Détermination des gènes candidats

Tests expérimentaux


  • Login