Implementasi solusi informasi bisnis
This presentation is the property of its rightful owner.
Sponsored Links
1 / 14


  • Uploaded on
  • Presentation posted in: General


Download Presentation


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Pertemuan III









Merupakanlingkupaktivitasperdagangansecaraelektronikdalamartiluassertaterpentingdanterbesardari e-business adalah ecommerce, dimanaberbagaiaktivitastransaksijualbelidilakukanmelalui medium internet. Karenasangatlebarnyaspektrumprosesdaritransaksijualbeli yang ada, sangatsulitmenentukanruanglingkupataubatasandari domain e-commerce. Salahsatucara yang dapatdipergunakanuntukdapatmengertibatasan-batasandarisebuah e-commerce adalahdenganmencobamengkajidanmelihatfenomenabisnistersebutdariberbagaidimensi, yaitu ;


  • Kontributorterbesar yang memungkinkanterjadinya e-commerce adalahteknologiinformasi, dalamhaliniperkembanganpesatteknologikomputerdantelekomunikasi. Tidakdapatdipungkiribahwa arena jualbelididuniamayaterbentukkarenaterhubungnyaberjuta-jutakomputerkedalamsebuahjaringanraksasa (internet).

Marketing dan “New Consumer Processes”

Dari segipemasaran, e-commerce seringdilihatsebagaisebuahkanalataucarabaruuntukberhubungandenganpelanggan. Melalui e-commerce jangkauansebuahperusahaanmenjadisemakinluaskarena yang bersangkutandapatmemasarkanprodukdanjasanyakeseluruhduniatanpamemperhatikanbatasan-batasangeografis.

Electronic Linkage

Denganadanya e-commerce, makaduabuahdivisidapatbekerjasamasecaraefisienmelaluipertukaran data elektronis; demikianjugaantaraduabuahkelompokberbedasepertimisalnyaantarakantorpemerintahdenganmasyarakatnya; ataumungkinantarapelanggandenganperusahaan-perusahaantertentu

Information Value Adding

Di dalam e-commerce, bahanbaku yang paling pentingadalahinformasi. Sehubungandenganhalini, prosespertambahannilai (value adding processes) menjadikunciterselenggaranyasebuahmekanisme e-commerce.


E-commerce dikatakansebagai market-making karenakeberadaannyasecaralangsungtelahmembentuksebuahpasarperdagangantersendiri yang mempertemukanberjuta-jutapenjualdanpembelidisebuahpasar digital maya (e-market). Di pasarmayainiterjadiperdagangansecaraterbukadanbebas, karenamasing-masingpenjualdanpembelidapatbertemusecaraefisientanpaperantara.

Service Infrastructure

Konsep e-commerce ternyatatidakhanyamembuahkanmekanismetransaksijualbelisemata, namunternyatabanyaksekalijasa-jasabaru yang diperlukansebagaisaranapendukungaktivitasjualbeliproduktersebut.


Merupakanlingkupperdagangan yang dilakukansecaraelektronikdimanadidalamnyatermasuk :

  • perdagangan via internet (internet commerce)

  • perdagangandenganfasilitas web internet (web e-commerce)

  • perdagangandengan system pertukaran data terstruktursecaraelektronik (Elektronik Data Interchange/EDI).

Pentingnya e-commerce

Orang yang inginmembelibarangatautransaksilewat internet hanyamembutuhkanakses internet dan interface-nyamenggunakan web browser Menjadikan portal e-commerce / e-shop tidaksekedar portal belanja, tapimenjaditempatberkumpulnyakomunitasdenganmembangun basis komunitas, membangunkonseppasarbukansekedartempatjualbelidansebagaipusatinformasi(release,product review, konsultasi, etc)

Pengelolaan yang berorientasipadapelayanan, kombinasikonsepsipelayanankonvensionaldan virtual : Responsif (respon yang cepatdanramah), Dinamis,InformatifdankomunikatifInformasi yang up to date, komunikasi multi-arah yang dinamis Model pembayaran : kartukreditatau transfer.

Tahapan-tahapandalamtransaksielektronikmelalui e-commerce


  • E-customer dan e-merchant bertemudalamduniamayamelalui server yang disewadari Internet Server Provider (ISP) oleh e-merchant.

  • Transaksimelalui e-commerce disertai term of use dan sales term condition atauklausulastandar, yang padaumumnya e-merchant telahmeletakkanklausulakesepakatanpada website-nya, sedangkan e-customer jikaberminattinggalmemilihtombol accept ataumenerima.

  • Penerimaan e-customer melaluimekanisme “klik” tersebutsebagaiperwujudandarikesepakatan yang tentunyamengikatpihak e-merchant.

  • Padasaatkeduabelahpihakmencapaikesepakatan, kemudiandiikutidenganprosespembayaran, yang melibatkandua bank perantaradarimasing-masingpihakyaitu acquiring merchant bank dan issuing customer bank.Prosedurnya e-customer memerintahkankepada issuing customer bank untukdanatasnama e-customer melakukansejumlahpembayaranatashargabarangkepada acquiring merchant bank yang ditujukankepada e-merchant.

  • Setelahprosespembayaranselesaikemudiandiikutidenganprosespemenuhanprestasiolehpihak e-merchant berupapengirimanbarangsesuaidengankesepakatanmengenaisaatpenyerahandanspesifikasibarang.


  • Login