Implementasi solusi informasi bisnis
Sponsored Links
This presentation is the property of its rightful owner.
1 / 14

IMPLEMENTASI SOLUSI INFORMASI BISNIS PowerPoint PPT Presentation


  • 190 Views
  • Uploaded on
  • Presentation posted in: General

IMPLEMENTASI SOLUSI INFORMASI BISNIS. Pertemuan II I RUANG LINGKUP E-BISNIS. Ruang lingkup e- bisnis. E-BISNIS. E-COMMERCE. INTERNET COMMERCE. E D I. WEB-COMMERCE. E-BISNIS.

Download Presentation

IMPLEMENTASI SOLUSI INFORMASI BISNIS

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


IMPLEMENTASI SOLUSI INFORMASI BISNIS

Pertemuan III

RUANG LINGKUP E-BISNIS


Ruanglingkupe-bisnis

E-BISNIS

E-COMMERCE

INTERNET COMMERCE

E D I

WEB-COMMERCE


E-BISNIS

Merupakanlingkupaktivitasperdagangansecaraelektronikdalamartiluassertaterpentingdanterbesardari e-business adalah ecommerce, dimanaberbagaiaktivitastransaksijualbelidilakukanmelalui medium internet. Karenasangatlebarnyaspektrumprosesdaritransaksijualbeli yang ada, sangatsulitmenentukanruanglingkupataubatasandari domain e-commerce. Salahsatucara yang dapatdipergunakanuntukdapatmengertibatasan-batasandarisebuah e-commerce adalahdenganmencobamengkajidanmelihatfenomenabisnistersebutdariberbagaidimensi, yaitu ;


Teknologi

  • Kontributorterbesar yang memungkinkanterjadinya e-commerce adalahteknologiinformasi, dalamhaliniperkembanganpesatteknologikomputerdantelekomunikasi. Tidakdapatdipungkiribahwa arena jualbelididuniamayaterbentukkarenaterhubungnyaberjuta-jutakomputerkedalamsebuahjaringanraksasa (internet).


Marketing dan “New Consumer Processes”

Dari segipemasaran, e-commerce seringdilihatsebagaisebuahkanalataucarabaruuntukberhubungandenganpelanggan. Melalui e-commerce jangkauansebuahperusahaanmenjadisemakinluaskarena yang bersangkutandapatmemasarkanprodukdanjasanyakeseluruhduniatanpamemperhatikanbatasan-batasangeografis.


Electronic Linkage

Denganadanya e-commerce, makaduabuahdivisidapatbekerjasamasecaraefisienmelaluipertukaran data elektronis; demikianjugaantaraduabuahkelompokberbedasepertimisalnyaantarakantorpemerintahdenganmasyarakatnya; ataumungkinantarapelanggandenganperusahaan-perusahaantertentu


Information Value Adding

Di dalam e-commerce, bahanbaku yang paling pentingadalahinformasi. Sehubungandenganhalini, prosespertambahannilai (value adding processes) menjadikunciterselenggaranyasebuahmekanisme e-commerce.


Market-Making

E-commerce dikatakansebagai market-making karenakeberadaannyasecaralangsungtelahmembentuksebuahpasarperdagangantersendiri yang mempertemukanberjuta-jutapenjualdanpembelidisebuahpasar digital maya (e-market). Di pasarmayainiterjadiperdagangansecaraterbukadanbebas, karenamasing-masingpenjualdanpembelidapatbertemusecaraefisientanpaperantara.


Service Infrastructure

Konsep e-commerce ternyatatidakhanyamembuahkanmekanismetransaksijualbelisemata, namunternyatabanyaksekalijasa-jasabaru yang diperlukansebagaisaranapendukungaktivitasjualbeliproduktersebut.


E-COMMERCE

Merupakanlingkupperdagangan yang dilakukansecaraelektronikdimanadidalamnyatermasuk :

  • perdagangan via internet (internet commerce)

  • perdagangandenganfasilitas web internet (web e-commerce)

  • perdagangandengan system pertukaran data terstruktursecaraelektronik (Elektronik Data Interchange/EDI).


Pentingnya e-commerce

Orang yang inginmembelibarangatautransaksilewat internet hanyamembutuhkanakses internet dan interface-nyamenggunakan web browser Menjadikan portal e-commerce / e-shop tidaksekedar portal belanja, tapimenjaditempatberkumpulnyakomunitasdenganmembangun basis komunitas, membangunkonseppasarbukansekedartempatjualbelidansebagaipusatinformasi(release,product review, konsultasi, etc)

Pengelolaan yang berorientasipadapelayanan, kombinasikonsepsipelayanankonvensionaldan virtual : Responsif (respon yang cepatdanramah), Dinamis,InformatifdankomunikatifInformasi yang up to date, komunikasi multi-arah yang dinamis Model pembayaran : kartukreditatau transfer.


Tahapan-tahapandalamtransaksielektronikmelalui e-commerce

dapatdiurutkansebagaiberikut;

  • E-customer dan e-merchant bertemudalamduniamayamelalui server yang disewadari Internet Server Provider (ISP) oleh e-merchant.

  • Transaksimelalui e-commerce disertai term of use dan sales term condition atauklausulastandar, yang padaumumnya e-merchant telahmeletakkanklausulakesepakatanpada website-nya, sedangkan e-customer jikaberminattinggalmemilihtombol accept ataumenerima.

  • Penerimaan e-customer melaluimekanisme “klik” tersebutsebagaiperwujudandarikesepakatan yang tentunyamengikatpihak e-merchant.


  • Padasaatkeduabelahpihakmencapaikesepakatan, kemudiandiikutidenganprosespembayaran, yang melibatkandua bank perantaradarimasing-masingpihakyaitu acquiring merchant bank dan issuing customer bank.Prosedurnya e-customer memerintahkankepada issuing customer bank untukdanatasnama e-customer melakukansejumlahpembayaranatashargabarangkepada acquiring merchant bank yang ditujukankepada e-merchant.

  • Setelahprosespembayaranselesaikemudiandiikutidenganprosespemenuhanprestasiolehpihak e-merchant berupapengirimanbarangsesuaidengankesepakatanmengenaisaatpenyerahandanspesifikasibarang.


Kesimpulan


  • Login