Bab 12 menentukan strategi produk
Sponsored Links
This presentation is the property of its rightful owner.
1 / 18

Bab 12 Menentukan Strategi Produk PowerPoint PPT Presentation


  • 2030 Views
  • Uploaded on
  • Presentation posted in: General

Bab 12 Menentukan Strategi Produk. Pentingnya Produk. Inti Merek yang hebat adalah Produk Yang Hebat Produk adalah elemen kunci dalam penawaran pasar Pemimpin pasar biasanya menawarkan produk yang bermutu tinggi yang memberikan nilai pelanggan yang unggul. Definisi Produk.

Download Presentation

Bab 12 Menentukan Strategi Produk

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Bab 12MenentukanStrategiProduk


PentingnyaProduk

  • IntiMerek yang hebatadalahProduk Yang Hebat

  • Produkadalahelemenkuncidalampenawaranpasar

  • Pemimpinpasarbiasanyamenawarkanproduk yang bermututinggiyang memberikannilaipelanggan yang unggul


DefinisiProduk

  • Segalasesuatu yang dapatditawarkankepadapasaruntukmemuaskansuatukeinginanataukebutuhan, termasukfisik, jasa, pengalaman, acara, orangtempat, properti, organisasidan etc

Lima Tingkat Produk: HierarkiNilaiPelanggan

KompenenPenawaranPasar


KlasifikasiProduk

  • PemasarMengklasifikasikanprodukberdasarkan:

    • Ketahanan/Durabilitas

    • Keberwujudan/Tangibility

    • Kegunaan KonsumenatauIndustri

  • Pemasarmenggolongkan 3 kelompokmenurutKetahanan & Keberwujudannya

    • Barang-barangtahan lama

    • Barang-barangtidaktahan lama

    • Jasa


KlasifikasiBarangKonsumen

  • Barangsehari-hari (Convenience goods)

    • Barangkebutuhanpokok

    • Barang impulse (dibelitanpaperencanaan)

    • Barangdarurat (Dibelisaatmendesak)

  • Barangbelanja (Shopping Goods)

    • BarangHomogen (kualitasserupa, hargacukupberbeda)

    • BarangHeterogen (Fiturdanjasaberbedalebihpentingdariharga)

  • BarangKhusus (Specialty Goods): mempunyaikarakteristikdanidentifikasimerek yang unikdancukupbanyakpembeli yang inginpembeliankhusus

  • Barang yang tidakdicari (Unsought Goods): barang yang tidakdikenalatautidakterpikirkanuntukdibeli


KlasifikasiBarangIndustri

  • BahandanSukuCadang: Barang yang seluruhnyamenjadibagiandariprodukprodusenie: bahanmentah, bahandansukucadangmanufaktur.

  • Barang Modal: barangtahan lama yang menfasilitasipengembangandanpengelolaanprodukjadi, ie: instalasi & peralatan

  • LayananBisnis & Pasokan: barangdanjasajangkapendekyangmanfasilitasipengembangandanpengelolaanprodukjadi, ie: MRO, Barangpemeliharaandanperbaikan


Diferensiasi

  • Agar dapatdijadikanmerek, produkharusdidiferensiasikan, terdiri:

  • DiferensiasiProduk

  • DiferensiasiJasa


Hubunganproduk & Merek: HirearkiProduk

Unit yang berbedadidalamliniprodukataumerek yang dibedakanberdasarkanukuran, harga, tampilan, atribut

Asuransijiwaberjangka PRUDENTIAL yang dpatdiperbarui

Barang

Sekelompokbarangdidalamliniproduk yang berbagisatudaribeberapakemungkinanbentukproduk

TipeProduk

AsuransijiwaBerjangka

Kelompokprodukdidalamkelasproduk yang berhubunganeratkarenamempunyaifungsi yang serupa, dijualkepadakelompokpelanggan, gerai/saluranataumemilikiharga yang sama

LiniProduk

AsuransiJiwa

Kelompokprodukdidalamkeluargaproduk yang dikenaldenganfungsionalitasygkoheren

KelasProduk

Instrumenkeuangan

Tabungan danpenghasilan

Semuakelasproduk yang dapatmemuaskankebutuhanintidenganefektif

KeluargaProduk

KeluargaKebutuhan

Kebutuhaninti yang mendasarikeberadaankeluargaproduk

Keamanan


Sistem & BauranProduk

  • SistemProduk: kelompokbarang yang berbedatetapiberhubungandanberfungsidengancara yang kompatibelie: liniproduksmartphone, e-book, kamera

  • Bauranproduk: Kumpulan semuaprodukdanbarang yang ditawarkanuntukdijualolehpenjualtertentu, terdiridari: lebar, Panjang, Kedalaman, konsistensi


AnalisisLiniProduk

  • Penjualan & Laba

    Pemasarharusmengetahuipenjualandanlabasetiap item dalamliniprodukmerekaitemmana yang dibuat, dipertahankan, dipanen, divestasi

  • ProdukInti: Volume penjualantinggi, dipromosikanbesar-besaran, margin rendah

  • Produkdasar: volume penjualanrendah, tanpapromosi, margin tinggi

  • ProdukKhusus:VolumePenjualanrendah, promosibesar-besaran

  • Barangsehari-hari: Volume tinggi, kurangpromosi, margin tinggi


AnalisisLiniProduk: ProfilPasar

Manajerliniharusmeninjaubagaimanaliniitudiposisikanterhadaplinipesaing.

  • Peta product (product map) memperlihatkan item pesaing, kemungkinanlokasiuntuk item baru, dansegmenpasar.

ContohPetaProduk Perusahaan kertas


MemperpanjangLiniProduk

Perusahaan inginmemperpanjangliniprodukdengantujuan:

  • Menciptakanliniprodukuntukmendorongpenjualankeatas

  • Menciptakanliniproduk yang memfasilitasipenjualansilang

  • Menciptakanliniproduk yang terlindungdaripeningkatandanpenurunankondisiekonomi

  • Cara memperpanjangliniproduk:

  • Perpanjanganlini(line streching),yakniketikaperusahaanmemperpanjangliniproduknyadiluarkisarannyasaatini

  • Pengisianlini, yaknimenambahkanlebihbanyakbarangdalamkisaransaatini


PerpanjanganLini (Line Stretching)

  • PerpanjangankeBawahPasar

  • PerpanjangankeAtasPasar

  • PerpanjangankeDuaArah

Contoh:GAPmenciptakan

merkOld Navyuntukproduk

denganhargalebihmurah.

Contoh:Toyota menciptakanmerkLexus untukprodukmobilkelasatas.

Contoh: Perusahaan anggurRobert MondaviMinerymenjual 3 macamanggur:

AnggurNew Worldseharga $35

AnggurMondavi Reserve seharga $85

AnggurWoodbridgeseharga $11


PengisianLini (Line Filling)

  • Motif pengisianlini (line filling) adalah:

  • Menghasilkanlabatambahan

  • Memuaskankeluhanatasbanyaknyaprodukhilang

  • Berusahamenggunakankelebihankapasitas

  • Berusahamenjadiperusahaanlinipenuhterkemuka

  • Berusahamenamballubanguntukmenyingkirkanpesaing

  • BerlebihanapabilamengakibatkanKanibalisasiProdukdankebingunganPelanggan


Co Branding

  • Pemasarseringmenggabungkanprodukmerekadenganprodukdariperusahaan lain denganberbagaicara

  • Co Branding: Duaataulebihmerekterkenaldigabungkanmenjadisatuprodukbersamaataudipasarkanbersamadalambeberapacara

  • Kelebihanutama Co Branding:

    • Produkdapatdiposisikansecarameyakinkanmelaluikelebihanberbagaimereklainnya

    • Membukapeluangtambahanbagikonsumendansaluranbaru

    • Mampumengurangibiayapeluncuranproduk

    • Saranaberhargauntukmempelajarikonsumendanbagaimanaperusahaan lain mendekatimereka


Contoh Co Branding


Pengemasan, Pelabelan, Jaminan & Garansi

  • Pengemasan:Semuakegiatanmerancangdanmemproduksiwadahuntuksebuahproduk

  • Pelabelan: namamerekdansejumlahinformasiuntukmengidentifikasikanproduk, memperingkatproduk, menggambarkanprodukataumempromosikannya

  • Jaminan: PernyataanResmikinerjaproduk yang diharapkanolehprodusen

  • Garansi: Pernyataan yang digunakanuntukmengurangiresikoanggapanpembeli


END…


  • Login