Bab 12 menentukan strategi produk
1 / 18

Bab 12 Menentukan Strategi Produk - PowerPoint PPT Presentation

  • Uploaded on

Bab 12 Menentukan Strategi Produk. Pentingnya Produk. Inti Merek yang hebat adalah Produk Yang Hebat Produk adalah elemen kunci dalam penawaran pasar Pemimpin pasar biasanya menawarkan produk yang bermutu tinggi yang memberikan nilai pelanggan yang unggul. Definisi Produk.

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about ' Bab 12 Menentukan Strategi Produk' - lazaro

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Bab 12 menentukan strategi produk
Bab 12MenentukanStrategiProduk

Pentingnya produk

  • IntiMerek yang hebatadalahProduk Yang Hebat

  • Produkadalahelemenkuncidalampenawaranpasar

  • Pemimpinpasarbiasanyamenawarkanproduk yang bermututinggiyang memberikannilaipelanggan yang unggul

Definisi produk

  • Segalasesuatu yang dapatditawarkankepadapasaruntukmemuaskansuatukeinginanataukebutuhan, termasukfisik, jasa, pengalaman, acara, orangtempat, properti, organisasidan etc

Lima Tingkat Produk: HierarkiNilaiPelanggan


Klasifikasi produk

  • PemasarMengklasifikasikanprodukberdasarkan:

    • Ketahanan/Durabilitas

    • Keberwujudan/Tangibility

    • Kegunaan KonsumenatauIndustri

  • Pemasarmenggolongkan 3 kelompokmenurutKetahanan & Keberwujudannya

    • Barang-barangtahan lama

    • Barang-barangtidaktahan lama

    • Jasa

Klasifikasi barang konsumen

  • Barangsehari-hari (Convenience goods)

    • Barangkebutuhanpokok

    • Barang impulse (dibelitanpaperencanaan)

    • Barangdarurat (Dibelisaatmendesak)

  • Barangbelanja (Shopping Goods)

    • BarangHomogen (kualitasserupa, hargacukupberbeda)

    • BarangHeterogen (Fiturdanjasaberbedalebihpentingdariharga)

  • BarangKhusus (Specialty Goods): mempunyaikarakteristikdanidentifikasimerek yang unikdancukupbanyakpembeli yang inginpembeliankhusus

  • Barang yang tidakdicari (Unsought Goods): barang yang tidakdikenalatautidakterpikirkanuntukdibeli

Klasifikasi barang industri

  • BahandanSukuCadang: Barang yang seluruhnyamenjadibagiandariprodukprodusenie: bahanmentah, bahandansukucadangmanufaktur.

  • Barang Modal: barangtahan lama yang menfasilitasipengembangandanpengelolaanprodukjadi, ie: instalasi & peralatan

  • LayananBisnis & Pasokan: barangdanjasajangkapendekyangmanfasilitasipengembangandanpengelolaanprodukjadi, ie: MRO, Barangpemeliharaandanperbaikan


  • Agar dapatdijadikanmerek, produkharusdidiferensiasikan, terdiri:

  • DiferensiasiProduk

  • DiferensiasiJasa

Hubungan produk merek hirearki produk
Hubunganproduk & Merek: HirearkiProduk

Unit yang berbedadidalamliniprodukataumerek yang dibedakanberdasarkanukuran, harga, tampilan, atribut

Asuransijiwaberjangka PRUDENTIAL yang dpatdiperbarui


Sekelompokbarangdidalamliniproduk yang berbagisatudaribeberapakemungkinanbentukproduk



Kelompokprodukdidalamkelasproduk yang berhubunganeratkarenamempunyaifungsi yang serupa, dijualkepadakelompokpelanggan, gerai/saluranataumemilikiharga yang sama



Kelompokprodukdidalamkeluargaproduk yang dikenaldenganfungsionalitasygkoheren



Tabungan danpenghasilan

Semuakelasproduk yang dapatmemuaskankebutuhanintidenganefektif



Kebutuhaninti yang mendasarikeberadaankeluargaproduk


Sistem bauran produk
Sistem & BauranProduk

  • SistemProduk: kelompokbarang yang berbedatetapiberhubungandanberfungsidengancara yang kompatibelie: liniproduksmartphone, e-book, kamera

  • Bauranproduk: Kumpulan semuaprodukdanbarang yang ditawarkanuntukdijualolehpenjualtertentu, terdiridari: lebar, Panjang, Kedalaman, konsistensi

Analisis lini produk

  • Penjualan & Laba

    Pemasarharusmengetahuipenjualandanlabasetiap item dalamliniprodukmerekaitemmana yang dibuat, dipertahankan, dipanen, divestasi

  • ProdukInti: Volume penjualantinggi, dipromosikanbesar-besaran, margin rendah

  • Produkdasar: volume penjualanrendah, tanpapromosi, margin tinggi

  • ProdukKhusus:VolumePenjualanrendah, promosibesar-besaran

  • Barangsehari-hari: Volume tinggi, kurangpromosi, margin tinggi

Analisis lini produk profil pasar
AnalisisLiniProduk: ProfilPasar


  • Peta product (product map) memperlihatkan item pesaing, kemungkinanlokasiuntuk item baru, dansegmenpasar.

ContohPetaProduk Perusahaan kertas

Memperpanjang lini produk

Perusahaan inginmemperpanjangliniprodukdengantujuan:

  • Menciptakanliniprodukuntukmendorongpenjualankeatas

  • Menciptakanliniproduk yang memfasilitasipenjualansilang

  • Menciptakanliniproduk yang terlindungdaripeningkatandanpenurunankondisiekonomi

  • Cara memperpanjangliniproduk:

  • Perpanjanganlini(line streching),yakniketikaperusahaanmemperpanjangliniproduknyadiluarkisarannyasaatini

  • Pengisianlini, yaknimenambahkanlebihbanyakbarangdalamkisaransaatini

Perpanjangan lini line stretching
PerpanjanganLini (Line Stretching)

  • PerpanjangankeBawahPasar

  • PerpanjangankeAtasPasar

  • PerpanjangankeDuaArah


merkOld Navyuntukproduk


Contoh:Toyota menciptakanmerkLexus untukprodukmobilkelasatas.

Contoh: Perusahaan anggurRobert MondaviMinerymenjual 3 macamanggur:

AnggurNew Worldseharga $35

AnggurMondavi Reserve seharga $85

AnggurWoodbridgeseharga $11

Pengisian lini line filling
PengisianLini (Line Filling)

  • Motif pengisianlini (line filling) adalah:

  • Menghasilkanlabatambahan

  • Memuaskankeluhanatasbanyaknyaprodukhilang

  • Berusahamenggunakankelebihankapasitas

  • Berusahamenjadiperusahaanlinipenuhterkemuka

  • Berusahamenamballubanguntukmenyingkirkanpesaing

  • BerlebihanapabilamengakibatkanKanibalisasiProdukdankebingunganPelanggan

Co branding
Co Branding

  • Pemasarseringmenggabungkanprodukmerekadenganprodukdariperusahaan lain denganberbagaicara

  • Co Branding: Duaataulebihmerekterkenaldigabungkanmenjadisatuprodukbersamaataudipasarkanbersamadalambeberapacara

  • Kelebihanutama Co Branding:

    • Produkdapatdiposisikansecarameyakinkanmelaluikelebihanberbagaimereklainnya

    • Membukapeluangtambahanbagikonsumendansaluranbaru

    • Mampumengurangibiayapeluncuranproduk

    • Saranaberhargauntukmempelajarikonsumendanbagaimanaperusahaan lain mendekatimereka

Contoh co branding
Contoh Co Branding

Pengemasan pelabelan jaminan garansi
Pengemasan, Pelabelan, Jaminan & Garansi

  • Pengemasan:Semuakegiatanmerancangdanmemproduksiwadahuntuksebuahproduk

  • Pelabelan: namamerekdansejumlahinformasiuntukmengidentifikasikanproduk, memperingkatproduk, menggambarkanprodukataumempromosikannya

  • Jaminan: PernyataanResmikinerjaproduk yang diharapkanolehprodusen

  • Garansi: Pernyataan yang digunakanuntukmengurangiresikoanggapanpembeli
