Bab 12 menentukan strategi produk
Download
1 / 18

Bab 12 Menentukan Strategi Produk - PowerPoint PPT Presentation


  • 2378 Views
  • Uploaded on

Bab 12 Menentukan Strategi Produk. Pentingnya Produk. Inti Merek yang hebat adalah Produk Yang Hebat Produk adalah elemen kunci dalam penawaran pasar Pemimpin pasar biasanya menawarkan produk yang bermutu tinggi yang memberikan nilai pelanggan yang unggul. Definisi Produk.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' Bab 12 Menentukan Strategi Produk' - lazaro


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Bab 12 menentukan strategi produk
Bab 12MenentukanStrategiProduk


Pentingnya produk
PentingnyaProduk

  • IntiMerek yang hebatadalahProduk Yang Hebat

  • Produkadalahelemenkuncidalampenawaranpasar

  • Pemimpinpasarbiasanyamenawarkanproduk yang bermututinggiyang memberikannilaipelanggan yang unggul


Definisi produk
DefinisiProduk

  • Segalasesuatu yang dapatditawarkankepadapasaruntukmemuaskansuatukeinginanataukebutuhan, termasukfisik, jasa, pengalaman, acara, orangtempat, properti, organisasidan etc

Lima Tingkat Produk: HierarkiNilaiPelanggan

KompenenPenawaranPasar


Klasifikasi produk
KlasifikasiProduk

  • PemasarMengklasifikasikanprodukberdasarkan:

    • Ketahanan/Durabilitas

    • Keberwujudan/Tangibility

    • Kegunaan KonsumenatauIndustri

  • Pemasarmenggolongkan 3 kelompokmenurutKetahanan & Keberwujudannya

    • Barang-barangtahan lama

    • Barang-barangtidaktahan lama

    • Jasa


Klasifikasi barang konsumen
KlasifikasiBarangKonsumen

  • Barangsehari-hari (Convenience goods)

    • Barangkebutuhanpokok

    • Barang impulse (dibelitanpaperencanaan)

    • Barangdarurat (Dibelisaatmendesak)

  • Barangbelanja (Shopping Goods)

    • BarangHomogen (kualitasserupa, hargacukupberbeda)

    • BarangHeterogen (Fiturdanjasaberbedalebihpentingdariharga)

  • BarangKhusus (Specialty Goods): mempunyaikarakteristikdanidentifikasimerek yang unikdancukupbanyakpembeli yang inginpembeliankhusus

  • Barang yang tidakdicari (Unsought Goods): barang yang tidakdikenalatautidakterpikirkanuntukdibeli


Klasifikasi barang industri
KlasifikasiBarangIndustri

  • BahandanSukuCadang: Barang yang seluruhnyamenjadibagiandariprodukprodusenie: bahanmentah, bahandansukucadangmanufaktur.

  • Barang Modal: barangtahan lama yang menfasilitasipengembangandanpengelolaanprodukjadi, ie: instalasi & peralatan

  • LayananBisnis & Pasokan: barangdanjasajangkapendekyangmanfasilitasipengembangandanpengelolaanprodukjadi, ie: MRO, Barangpemeliharaandanperbaikan


Diferensiasi
Diferensiasi

  • Agar dapatdijadikanmerek, produkharusdidiferensiasikan, terdiri:

  • DiferensiasiProduk

  • DiferensiasiJasa


Hubungan produk merek hirearki produk
Hubunganproduk & Merek: HirearkiProduk

Unit yang berbedadidalamliniprodukataumerek yang dibedakanberdasarkanukuran, harga, tampilan, atribut

Asuransijiwaberjangka PRUDENTIAL yang dpatdiperbarui

Barang

Sekelompokbarangdidalamliniproduk yang berbagisatudaribeberapakemungkinanbentukproduk

TipeProduk

AsuransijiwaBerjangka

Kelompokprodukdidalamkelasproduk yang berhubunganeratkarenamempunyaifungsi yang serupa, dijualkepadakelompokpelanggan, gerai/saluranataumemilikiharga yang sama

LiniProduk

AsuransiJiwa

Kelompokprodukdidalamkeluargaproduk yang dikenaldenganfungsionalitasygkoheren

KelasProduk

Instrumenkeuangan

Tabungan danpenghasilan

Semuakelasproduk yang dapatmemuaskankebutuhanintidenganefektif

KeluargaProduk

KeluargaKebutuhan

Kebutuhaninti yang mendasarikeberadaankeluargaproduk

Keamanan


Sistem bauran produk
Sistem & BauranProduk

  • SistemProduk: kelompokbarang yang berbedatetapiberhubungandanberfungsidengancara yang kompatibelie: liniproduksmartphone, e-book, kamera

  • Bauranproduk: Kumpulan semuaprodukdanbarang yang ditawarkanuntukdijualolehpenjualtertentu, terdiridari: lebar, Panjang, Kedalaman, konsistensi


Analisis lini produk
AnalisisLiniProduk

  • Penjualan & Laba

    Pemasarharusmengetahuipenjualandanlabasetiap item dalamliniprodukmerekaitemmana yang dibuat, dipertahankan, dipanen, divestasi

  • ProdukInti: Volume penjualantinggi, dipromosikanbesar-besaran, margin rendah

  • Produkdasar: volume penjualanrendah, tanpapromosi, margin tinggi

  • ProdukKhusus:VolumePenjualanrendah, promosibesar-besaran

  • Barangsehari-hari: Volume tinggi, kurangpromosi, margin tinggi


Analisis lini produk profil pasar
AnalisisLiniProduk: ProfilPasar

Manajerliniharusmeninjaubagaimanaliniitudiposisikanterhadaplinipesaing.

  • Peta product (product map) memperlihatkan item pesaing, kemungkinanlokasiuntuk item baru, dansegmenpasar.

ContohPetaProduk Perusahaan kertas


Memperpanjang lini produk
MemperpanjangLiniProduk

Perusahaan inginmemperpanjangliniprodukdengantujuan:

  • Menciptakanliniprodukuntukmendorongpenjualankeatas

  • Menciptakanliniproduk yang memfasilitasipenjualansilang

  • Menciptakanliniproduk yang terlindungdaripeningkatandanpenurunankondisiekonomi

  • Cara memperpanjangliniproduk:

  • Perpanjanganlini(line streching),yakniketikaperusahaanmemperpanjangliniproduknyadiluarkisarannyasaatini

  • Pengisianlini, yaknimenambahkanlebihbanyakbarangdalamkisaransaatini


Perpanjangan lini line stretching
PerpanjanganLini (Line Stretching)

  • PerpanjangankeBawahPasar

  • PerpanjangankeAtasPasar

  • PerpanjangankeDuaArah

Contoh:GAPmenciptakan

merkOld Navyuntukproduk

denganhargalebihmurah.

Contoh:Toyota menciptakanmerkLexus untukprodukmobilkelasatas.

Contoh: Perusahaan anggurRobert MondaviMinerymenjual 3 macamanggur:

AnggurNew Worldseharga $35

AnggurMondavi Reserve seharga $85

AnggurWoodbridgeseharga $11


Pengisian lini line filling
PengisianLini (Line Filling)

  • Motif pengisianlini (line filling) adalah:

  • Menghasilkanlabatambahan

  • Memuaskankeluhanatasbanyaknyaprodukhilang

  • Berusahamenggunakankelebihankapasitas

  • Berusahamenjadiperusahaanlinipenuhterkemuka

  • Berusahamenamballubanguntukmenyingkirkanpesaing

  • BerlebihanapabilamengakibatkanKanibalisasiProdukdankebingunganPelanggan


Co branding
Co Branding

  • Pemasarseringmenggabungkanprodukmerekadenganprodukdariperusahaan lain denganberbagaicara

  • Co Branding: Duaataulebihmerekterkenaldigabungkanmenjadisatuprodukbersamaataudipasarkanbersamadalambeberapacara

  • Kelebihanutama Co Branding:

    • Produkdapatdiposisikansecarameyakinkanmelaluikelebihanberbagaimereklainnya

    • Membukapeluangtambahanbagikonsumendansaluranbaru

    • Mampumengurangibiayapeluncuranproduk

    • Saranaberhargauntukmempelajarikonsumendanbagaimanaperusahaan lain mendekatimereka


Contoh co branding
Contoh Co Branding


Pengemasan pelabelan jaminan garansi
Pengemasan, Pelabelan, Jaminan & Garansi

  • Pengemasan:Semuakegiatanmerancangdanmemproduksiwadahuntuksebuahproduk

  • Pelabelan: namamerekdansejumlahinformasiuntukmengidentifikasikanproduk, memperingkatproduk, menggambarkanprodukataumempromosikannya

  • Jaminan: PernyataanResmikinerjaproduk yang diharapkanolehprodusen

  • Garansi: Pernyataan yang digunakanuntukmengurangiresikoanggapanpembeli



ad