This presentation is the property of its rightful owner.
Sponsored Links
1 / 106


  • Uploaded on
  • Presentation posted in: General

PENCATATAN DALAM SISTEM NERACA NASIONAL. Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA. Siklus Proses Produksi. Enterpreneur (Management) Organization and Development of Other Three Factors. Land Natural Resources. Production Goods and Services. Capital

Download Presentation


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Bahan Perkuliahan SNN-PDB


Siklus Proses Produksi



Organization and

Development of

Other Three Factors





Goods and






Human Efforts

And Skills

Merupakan sumber daya alam yang paling dasar

  • “Sewa tanah”

  • harga atas peng-gunaan tanah

  • penghargaan yang diterima oleh pemilik atas keterlibatannya dalam proses produksi


Merupakan faktor produksi terpenting

“Upah dan gaji”

- penerimaan pekerja atas kontribusinya dalam berbagai proses produksi

“Tenaga kerja”

faktor produksi yang dibuat manusia dari sumber daya alam


- Termasuk penerimaan atas faktor kepemilikan kapital (deviden,royalti & properti lainnya)





penerimaan “keuntungan” wira usaha atas layanan serta resiko usahanya, bahkan kemungkinan kehilangan bisnisnya (rugi)


Kompensasi Atas Faktor Produksi




Pengeluaran rumahtangga (Output)


Perantara keuangan

Rest of the world

Pendapatan rumahtangga (Input)


Arus Siklus dari Pendapatan

ke faktor
















  • Moneter & non

  • moneter (barter)

  • Pasar & non pasar

  • Dengan & tanpa

  • pihak lain

  • Motif ekonomi

  • Resiko ekonomi

  • Neraca ber-jalan

  • Neraca aku-mulasi

  • Neraca akhir tahun

  • Cakupan

  • Acrual & cash/ tunai

  • Pencatatan ganda & quadraple

  • Penilaian &

  • penyesuaian


  • Perubahan :

  • Harga

  • volume

  • Perilaku

  • Jenis institusi

  • Unit Institusi







  • Gempa bumi

  • Banjir

  • Motif non ekonomi/sosial

  • Resiko non ekonomi/sosial

Lainnya :

peristiwa politik

Proses Pencatatan Dalam SNN



(Internal Acc)


(External Acc)

Tabel I-O




Tabel S-U

Factor Income


Current Transfer



Capital Transfer



Perangkat Data SNN Indonesia

Neraca B & J

Neraca Prod.

Neraca P P

Neraca K

Neraca F







Central framework





Tabel I-O


S & U

  • APC & MPC


  • Stok Kapital

  • Labor Productivity







Output Data Nasional

Input data

- …

- …


N. Energi


Pelaku ekonomi



Perilaku/aktivitas ekonomi



Arus/flows atau posisi/stocks





Sistem pencatatan dgn

format neraca



Prinsip Pencatatan SNNI – “5A”

ACTOR(PelakuEkonomi) &INSTITUTION(Unit Ekonomi)


Rest of the Word

(Luar Negeri)








(pelaku-pelaku ekonomi)

Klasifikasi Unit Ekonomi

  • Dua cara untuk mengklasifikasikan aktor ekonomi:

    • Unit Institusi  Sektor

    • Establishmen  Industri

  • Nasional

    • Neraca-neraca yang dikumpulkan dari unit institusi residen dikelompokkan ke dalam sektor dan sub-sektor

    • Tingkat propinsi dan kabupaten

Unit institusidanSektor

Unit Institusi

Unit Institusi:

Entitasekonomi yang atasnamanyadapatmemilikiasetdankewajiban, terlibatdalamaktivitasekonomi, danbertransaksidenganentitas lain


  • Berhakmemilikibarangdanaset, sehinggadapatmelakukanpertukaranmelaluiaktivitastransaksidengan unit institusi lain

  • Dapatmemutuskanuntukterlibatdalamaktivitasekonomi, sehinggabertanggungjawabdandapatmempertanggung-jawabkantindakanya di depanhukum

  • Hal di atasmenimbulkankewajiban, danatasnamanyadapatmelakukankomitmenatasdasarkepercayaanataukontrak formal

  • Memilikisatu set neracalengkap, ataucatatankeuangan yang memadaidarisudutekonomimaupunhukumgunadapatmenyusunneraca

Unit Institusi (lanjutan…)

Unit Institusi (lanjutan…)

  • Rumahtangga

    • Individurumahtanggaterdiridariindividuataukelompok individuyang tinggalbersamadalamsuatubangunantempattinggal. Secarabersamamerekamengelola pendapatandankekayaansertamengkonsumsi barang dan jasa utamanyakelompokmakanandanperumahan

    • Institusirumahtanggamerupakankelompok individuyang tinggal di rumah sakit, panti jompo, biara, dan tempatsejenisuntuk periode cukuplama. Secarakeseluruhanindividuataukelompokindividu yang ada diperlakukan sebagai satuunit

  • Entitas legal atau sosial

    • Entitasyang diakuiolehhukumataumasyarakat, dankeberadaanyaterpisahdari individu atau entitas lain yangmengendalikan. Entitasini bertanggung jawab atas tindakan ekonomi yang diambil meskipun otonominyadibatasi olehinstitusi lain. Entitasiniterdiridariunit korporasi, lembaga non-profit, danpemerintah

SektorInstitusi: kumpulan unit yang mempunyaifungsi, tujuandanperilaku yang samadidalamperekonomian



  • Korporasi (Finansial & Non-finansial)

  • Unit Pemerintah

  • Lembaga Non-profit Pelayan RT/LNPRT

  • Rumahtangga

  • Entitas legal yang menentukantujuankegiatandalammemproduksibarangdanjasauntukmemenuhipermintaanpasar, yang nantinyaakanmenjadisumberkeuntunganatauperolehanfinansial (gain) bagipemiliknya.

  • Merupakanusahakolektif yang dimilikiolehparapemegangsaham yang mempunyaiotoritasatauhakmengaturmanajemensecarakeseluruhan

1. Korporasi

  • Dibentuksecara legal (Terdaftar) sesuaidenganhukumnegarabersangkutan

  • Terlibatdalamproduksibarang-barangpasar

  • Kepemilikanberkaitandenganpemiliksahamsecarakolektif

  • Mempunyaisatu set neracasecaralengkap

  • Memilikiasetsendiri yang berbedadenganasetpemilik

  • Termasukkuasikorporatdankoperasi

1. Korporasi (lanjutan….)

1. Korporasi (lanjutan….)

  • Mampumenghasilkanlaba/keuntunganfinansial lain untukpemilik

  • Diakuisebagaibadanhukumygterpisahdrpemilikygmenikmatilaba

  • Hanyaterlibatdalamproduksiuntukkeperluanpasar

Institusi yang didirikanmelaluiprosespolitikdanmemilikikekuasaandibidanglegislatif, eksekutifmaupunyudikatifatas unit-unit lainnya yang beradadisuatuwilayahtertentu.

2. Unit Pemerintah

  • Establishment/ kel. Estab. pemerintahdenganproduksejenisdibawahmanajemenumumharusdiperlakukansebagaikorporasikuasibila:

    • Unit tsbmenetapkanharga output ygsignifikansecaraekonomi

    • Dikeloladandioperasikandgncaraserupakorporasi

    • Memilikisatu set neracalengkapsehinggadptdiukurdandiidentifikasisecaraterpisah

2. Unit Pemerintah (lanjutan….)

  • Peranpemerintah(dibentukdari unit-unit pemerintahan)

    • Mengorganisir/mendanaiproduksibarang/jasa non-pasar

    • Jasa individual & kolektifuntukrumahtanggadankomunitas

    • Terlibatdalamdistribusi/redistribusipendapatandankekayaanmelaluiPerpajakandan transfer lain

3. Unit Lembaga Non-Profit

Merupakan entitas legal maupun sosial yang didirikan dengan tujuan untuk menghasilkan barang dan jasa yang bukan merupakan sumber bagi pendapatan, keuntungan atau perolehan finansialnya

Khususnya ditujukan bagi unit-unit kegiatan yang dibangun, dikontrol serta dibiayai oleh mereka sendiri

3. Unit Lembaga Non-Profit (lanjutan…..)

  • Lembaga Non-profit yang MelayaniRumahTangga (LNPRT)

    • Entitas legal yang fungsiutamanyamemberikanjasa non-pasarkepadarumahtangga

    • Sumberdanautamaadalahdarisumbanganrumahtanggadaninstitusi lain

    • BagiandariLembaga Non-Profit (LNP), LNP lain yang melayanipemerintahdankorporasi

Org. formal informal ygdibentukolehperorangan, kel. masy, pemerintah, atauduniausahadalamrangkamenyediakanjasasosialkemasy., khususnyabagiangg. maupunkel. masy. tertentutanpaadanyamotivasimemperolehkeuntungan

3. Unit Lembaga Non-Profit (lanjutan….)

4. Rumahtangga

  • Individuataukelompokindividu yang tinggalbersamadalambangunantempattinggal, dimanamerekamengumpulkansebagianatauseluruhpendapatandankekayaansertamengkonsumsibarangdanjasasecarabersamaterutamamakanandanperumahan.

  • CakupanRumahTangga

    • Terdiridariorangataukumpulanorang yang masaksatudapur (pengaturanmakan yang sama)

    • Termasukusahatdkberbadanhukum

    • Pemasoktenagakerja; utamanyakonsumenakhir

    • Termasukaktivitasoperasionalrumahtangga

    • Termasuksektor informal

4. Rumahtangga (lanjutan….)

Unit InstitusiResiden

  • Suatuunit institusi menjadiresidensuatuwilayah ekonomi,jikamenjadipusat kepentingan ekonomi yang dominan di wilayahbersangkutan

  • Konsepresidendanwilayah ekonomi dirancangguna memastikan bahwa setiap unit institusi residenmasuk dalam satu wilayah ekonomi

  • Penggunaan wilayah ekonomi sebagai cakupanstatistikdapatdiartikanbahwasetiap anggota kelompok perusahaan afiliasi merupakanresiden perekonomian di mana diaberada, bukan berdasarkan lokasi keberadaankantorpusat

  • Unit institusidiklasifikasikansebagaiResiden, jikahanyamempunyaipusatkepentinganekonomidinegaratersebutyang ditandaidengan

  • Lokasitempatproduksiberadadidalamnegara

  • Bermaksuduntukmelakukanaktivitasnyasecaraberkelanjutandenganjangkawaktu yang tidakterbatasatauterbatas (paling sedikit 1 tahun)

  • Untukindividu, adalahlokasirumahnyadanbukantempatdiabekerja

Unit InstitusiResiden (lanjutan…..)

  • Untukusahatidakberbadanhukum, residensamadenganpemilikusaha

  • Untukkorporasidanlembaga non-profit, tempatmerekamendaftarkanusaha (secarakonsitusi legal)

  • Pemiliktanahdanbangunanpadasuatunegara, selaluberadadinegaratersebut

  • Kedutaan, konsulatdankeberadaanestablismenmiliterdiluarnegeri, dianggapsebagairesiden

  • Lembagainternasional (PBB, dsj) adalahbukanresiden (non-residen)

Unit InstitusiResiden (lanjutan…..)

Unit InstitusiResiden (lanjutan…..)

  • PemegangasetdanTransaktor.

  • Korporasi and kuasikorporasi

    • Non-finansial

    • Finansial

  • PemerintahanUmum

  • Rumahtanggadanusaharumahtanggatidakberbadanhukum

  • Lembagaswasta non-profit yang melayanirumahtangga


  • LuarNegeri

Enterprise, EstablismentdanIndustri

  • Unit-unit institusi yang terlibatdalamkegiatanprosesproduksi, seperti:

    • Korporasi

    • Institusi non-profit

    • Usaha bukan-korporasi

  • Secarasimultanberarti

    • Terlibatdalamkegiatanproduksi yang berbeda-beda

    • Menghasilkanberbagaimacam/jenisprodukbarangdanjasa


Cakupan Enterprise

Enterprise danEstablisment

  • Data yang diperolehdarisuatuestablismenmeliputi:

  • Item dalam neraca produksi dan neraca pendapatan yang diciptakan;

  • Data jumlahdan jenispekerja, sertajam kerjanya;

  • Perkiraan stok modal non-finansial, dan sumber daya alam yang digunakan;

  • Perkiraan perubahan stokdan PMTB yang dilakukan


  • Kelompokbeberapaestablismenygterlibatdalamkegiatanekonomi yang samaatausejenis

  • Tidakadakorespondensilangsung (one-to-one point) antaraaktivitasdenganproduk (ISIC & CPC).

Enterprise, EstablismentdanIndustri


  • “Institusi”sebagaidasardalampenyusunan diagram rangkaianneracasecaralengkap

  • “Establismen”sebagaidasaruntukanalisisproduksi, Supply and Usedan Input-Output






Perilaku Ekonomi


(kegiatan ekonomi)


  • Tipikaldariberbagaimacamaktivitasekonomi

  • Aktivitas yang disetarakandalamsatusatuanmoneter

  • Dasarbagipenyusunanneraca


  • Proses produksi

  • Distribusi dan redistribusi pendapatan

  • Konsumsi

  • Akumulasi/Investasi

AktivitasEkonomi (lanjutan…..)

  • Produksi: Perusahaan menggunakantenagakerjauntukmemproduksibarangdanjasadanmenjualnyakerumahtanggadanpenggunalainnya

  • Distribusi: Pendapatandaripenjualanbarangdanjasatersebutdigunakanuntukmembayarupahpekerjadankeuntunganbagipemilikperusahaan.

  • Konsumsi: Barang-barang (nondurabledandurable) danjasa-jasa yang dibeliolehrumahtangga; Pemerintahmembelibarangdanjasa-jasanondurable

  • Akumulasi: Barang-barang yang dibeliuntukdigunakandimasa yang akandatang – investasitetapuntukusaha, investasitetaptempattinggal (rumahtangga), daninventori


  • Untukmenghasilkanbarangdanjasasecaraspesifikdgnmengkombinasiberbagaisumberdayatersediasepertiperalatan, teknikindustri, tenagakerja, produk (bahanbaku)

  • Merupakansatuaktivitastunggal yang dalamprosesmenghasilkanberbagaiproduksecarahomogeensepertibuah, bahanmakanan, hasiltenun, mobil

AktivitasProduksi (lanjutan)

  • Aktivitasproduksimerupakanproses yang dilakukan di bawah kendali dan tanggung jawab unit institusi yang menggunakan input tenaga kerja, modal, barang dan jasa untuk menghasilkan output barang dan jasajenis lain

  • Klasifikasi aktivitasproduksi yang digunakan SNA adalah ISIC (Rev.4), yang terdiri dari 21 bagian, 88 divisi, 238 grup, dan 419 kelas

  • TipedariAktivitasproduksi

    • Aktivitasutama (pincipal activities)

    • Aktivitastambahan (secondary activities)

    • Aktivitaspenunjang (ancillary activities)

  • Aktivitasutamadari unit produsenmerupakanaktivtasgunamenghasilkannilaitambahmelebihinilaitambahaktivitas lain yang dilakukandalam unit yang sama.

  • Aktivitasutamasuatu enterprise terdiridariprodukutamadanprodukikutanyaituproduk yang diproduksibersamadenganprodukutama.

  • Output aktivitasutamamencakupbarangataujasa yang mampudisediakanuntuk unit lain, meskipundapatdigunakanuntukkonsumsisendiriataupembentukanmodlsendiri.


  • Aktivitassekundermerupakanaktivitas yang dilakukanoleh unit produsendisampingaktivitasutamanya, output aktivitassekunderjugadisediakanuntuk unit lain diluar unit produsen yang bersangkutan.

  • Nilaitambah yang dihasilkanolehaktivitassekunderharuslebihsedikitdariaktivitasutama.

  • Output dariaktivitassekundermerupakanproduksekunder. Banyakprodusenmenghasilkansetidaknyabeberapaproduksekunder.


  • Merupakanaktivitas yang bersifatinsidentialdarisuatu enterprise.

  • Aktivitasinidifasilitasisecaraefisienoleh enterprise tetapitidakmenghasilkanbarangdanjasauntukdipasarkan.





Akumulasi (Kapital)



Rumah tangga*)

Lembaga nirlaba




Luar negeri




  • Bagaimanamengukurnilaitindakan ?

    - Posisi/stok (stocks)

    - ArusEkonomi (flows)

  • Tipetindakan ?

    - Aset (harta)

    - Kewajiban (tanggungan)

  • Bagaimanacaramerekamnya ?


(Arus Ekonomi)



  • Produksi

  • PMTB

  • Konsumsi

  • Penduduk

  • PMTB

  • Aset

  • Penduduk

  • Hutang

  • Tabungan



Arus (Flows) danPosisi (Stocks)

  • ArusEkonomi (Flows) :Untukmengkuantifikasitindakanekonomiataumengukurperubahannilaiekonomiselamaperiodewaktutertentu

  • Posisi (Stocks) : Untukmengukurperistiwaakibatkegiatan/ tindakanekonomipadawaktusebelumatausesudahkejadianekonomi.



Arus (Flows) danPosisi (Stocks)

  • Posisi(Stocks)sumberdayadiukurpadasuatutitikwaktutertentu

  • ArusEkonomi(Flows) dicatatdalambentukTansaksi (perubahankepemilikan) barang & jasa, aset & kewajiban, selamaperiodewaktutertentu

  • Mencerminkanpenciptaan, transformasi, pertukaran, transfer atauhilangnyanilaiekonomi

  • danmelibatkanperubahanpadakomposisi volume ataunilaiaset/kewajibaninstitusitertentu

  • Dilakukanolehinstitusidalamperekonomiandandiukurolehsektorinstitusiatauperekonomiansecarakeseluruhan


Contoh : Flows danStocks

  • Kemakmuran (Wealth), Pendapatan (income) danpengeluaran (expenditure)

  • Kapital (modal) danInvestasi

  • HutangPemerintah

  • Kerugiananggaran

  • Aset/Harta

  • Tabungan

  • Inventori/Persediaan

Stokaset & kewajiban

(1 January 2005)


Arusekonomibarang & jasa, pendapatan, aset, kewajiban, dst.,

(1 Jan 2005- 31 Dec 2005)



(31 December 2005)


  • Dengan perjanjian para pihak terkait

    • Antar unit institusi

    • Didalam unit institusi yang beroperasi dengan kapasitas berbeda

  • Arus lain – perubahan nilai aset dan kewajiban tanpa transaksi

    • Perubahan volume

    • Tingkat dan struktur harga

JenisTransaksi (ArusEkonomi

  • Barang dan Jasa: menunjukkan asal dan penggunaan

  • Distributif (Pendapatan): arus pendapatan yang dihasilkan oleh produksi atas faktor; dan redistribusi pendapatan

  • Instrumen Finansial: akuisi neto dari aset finansial atau pemenuhan kewajiban

  • Akumulasi lain: perubahan kuantitas atau nilai aset & kewajiban (penemuan/pengurangan aset sub-soil, pembelian tanah, keuntungan, kerugian karena perubahan harga


  • Transaksi dengan mitra (“lawan”)

    sesuatu untuk sesuatu

  • Transaksi tanpa mitra (“lawan”)

    sesuatu untuk nihil

Jasa tenaga kerja



Transaksi Non-Moneter

  • Barter

  • Penyusutan modal tetap

  • Pemberianupahdalambentukbarang

  • Transfer dalambentukbarang









Awal Tahun

Pendapatan & pengeluaran









Format SajianNeraca

  • Neraca “T” : terbagidalam 2 lajur, kiridankanan.

    Lajurkananmerekamberbagaitransaksisumber (source) sedanglajurkiritransaksipenggunaan (uses).

  • Tabel : rekapitulasineraca “T”

  • Matriks:

    Penyajianneracadalambentukposisisejumlahbaris (m) dansejumlahkolom (n), gunanyauntukmenunjukanhubungantransaksisecaralangsung

Neraca “Tipe T”


Format Tabel

Format Matriks


Tiga jenis neraca pokok :

  • Neraca transaksi berjalan (Current accounts)

  • Neraca Akumulasi (Accumulation accounts)

  • Neraca Akhir tahun (Balance sheets)


(Current Accounts)

  • Neraca Produksi

  • Neraca Pendapatan & penggunaan

    • Distribusi primer pendapatan

    • Distribusi sekunder pendapatan

    • Redistribusi pendapatan (inkind)

  • Neraca penggunaan pendapatan



Item utama

  • Output (keluaran)

  • Konsumsi (biaya) antara

  • Konsumsi barang modal tetap


  • Nilai tambah (Value added)


NilaiTambah (BrutodanNeto)

Nilai Tambah Bruto

  • Output

    (minus) biaya/konsumsi antara

    Nilai tambah Neto

  • Output

    (minus) biaya/konsumsi antara

    (minus) konsumsi barang modal tetap


ProduksidanDistribusi Primer

Output :

(-)input bahanbaku = PDB

(-)input barang modal tetap= PDN

(-)input tenagakerja = Surplus usaha &


(+)Pendapatanpemilikan, neto = PendapatanNasional


Transfer sosial

  • Bentuk tunai

  • Bentuk barang

    Butir (item) penyeimbang: Pendapatan/penerimaan disposabel Nasional/Regional


Pendapatan disposabel

(-)Pengeluaran konsumsi aktual

= Tabungan (bruto/neto)



(Accumulation Accounts)

  • Neraca kapital

  • Neraca finansial

  • Perubahan lain dalam aset

  • Neraca revaluasi


(Balance Sheets)

  • Opening balance sheet

  • Closing balance sheet



Double entry

(pencatatan ganda)

Quadraple entry

(pencatatan 4 x)



PencatatanDua Kali

(Double Entry)

  • Prinsip pencatatan ganda, sebagaimana dalam akuntansi perusahaan

  • Setiap transaksi dicatat dua kali

    • Sekali sebagai Sumber (atau perubahan pada kewajiban)

    • Sekali sebagai Penggunaan (atau perubahan pada aset)

  • Oleh karenanya Transaksi total pada kedua sisi harus sama

PencatatanEmpat Kali

(Quadraple Entry)

  • Dalam neraca nasional yang terdiri dari semua sektor institusi, prinsip pencatatan empat kali dipakai karena sebagian besar transaksi melibatkan dua sektor institusi, sehingga pencatatan dua kali (untuk satu sektor) menjadi empat kali.










































Int. Ner.












  • Penilaian, (yang mana ?)

    - Arus (Flows) dan

    - Stok (Stocks)

  • Waktu pencatatan (bilamana ?)

    - Akrual (accrual) dan

    - Tunai (cash)

  • Pengelompokkan (mengapa ?)

    - Neto

    - Konsolidasi

    - Agregasi

Basis Akrual

  • Sistem ini merekomendasikan untuk selalu menggunakan basis akrual dalam setiap pencatatan transaksi

  • Akuntansi akrual mencatat arus pada saat nilai ekonominya terbentuk akibat dari proses transformasi, pertukaran, transfer atau punah

  • Sistem akuntansi akrual hanya dapat diaplikasikan untuk mencatat arus “non-moneter” saja

Basis Akrual Vs Basis Tunai

  • Basis Akrual

    • Penerimaan dicatat apabila barang sudah dijual atau jasa digunakan

    • Pengeluaran dicatat apabila biaya untuk menghasilkan penerimaan sudah dikeluarkan

  • Basis Tunai

    • Penerimaan dicatat apabila sudah diterima secara tunai

    • Pengeluaran dicatat apabila sudah terjadi pengeluaran secara tunai


  • Periode akuntansi diantara 2 (dua) waktu pencatatan balance sheet

  • Banyak kegiatan mengawali aktivitasnya pada suatu periode akuntansi dan berakhir pd periode akuntansi berikutnya

  • Dua tipe pendekatan pengukuran yang digunakan untuk mengukur perfoma tersebut adalah

    “basis akrual vs basis tunai”



  • Neto

  • Konsolidasi

  • Agregasi

Consolidated SNA Matrix with Sub-Accounts


  • SisikanandariNeracaberjalanadalahSumber (transaksi yang menambahjumlahnilaiekonomidarisektor, misalnya output dalamneracaproduksi)

  • SisikiridariNeracaberjalanadalahPenggunaan (transaksi yang menguranginilaiekonomidarisektor, misalnyakonsumsiantarapadaneracaproduksi)


  • SisikanandariNeracaAkhirTahun (NAT) adalahKewajibandanKekayaanbersih (selisihantaraasetdankewajiban)

  • SisikiridariNeracaAkhirTahunadalahAset

  • DenganmembandingkanduaNeracaAkhirTahunpadatahun yang berurutankitadapatmengetahuiperubahandalamKewajiban and KekayaanBersihdanperubahanAset


  • Neracaakumulasidan NAT merupakanneraca yang terintegrasisecarapenuh, SisikanandariNeracaakumulasiadalahPerubahanpadakewajibandanKekayaanbersih

  • SisikiridariNeracaAkumulasidisebutPerubahanpadaAset

  • Dalamkasustransaksipadainstrumenfinansial, iniberkaitandenganpemenuhankewajiban (neto) danakuisisiasetfinansial (neto)

AturanAkuntansi - Rerouting

  • Rerouting transactions

    • Iuranpemberikerja/majikanuntukjaminansosial (Pemberikerjamembayarsahamuntukiuranjaminansosialkepadadanajaminansosial)

    • Pemberikerja (untukpekerja) jaminansosial

  • Partitioning transactions


    amortisasi > cicilanhutang (pokok) + bunga

AturanAkuntansi - Penilaian

  • Transaksidinilaiatasdasarhargasebenarnya yang disetujuiolehpelakutransaksi

  • Nilaiatasdasarhargapasar

    • Nilaididasarkanpadahargadipasar

  • Untuktransaksinon-pasarpenilaiandibuatmenurutBiaya yang terjadi

AturanAkuntansi – PencatatanTransaksi

  • Nilaiprodukapakahmenurut

    • Hargadasar

    • Hargaprodusen

    • Hargapembelian

  • Impordanekspordicatatpadanilaiperbatasan (border) (fob)

AturanAkuntansi – PencatatanTransaksi

  • Pencatatantransaksibruto

  • Pencatatantransaksineto

    P = Penggunaan S = Sumber





Transfer Kapital yang dibayar

Transfer Kapital yang diterima

Transfer Kapital neto yang diterima

Pencatatan Neto

Pencatatan Bruto

Pencatatan Transaksi

  • Barang dan Jasa * barang dan jasa

  • Barang dan Jasa * pendapatan

  • Barang dan Jasa * instrumen finansial

  • Pendapatan * instrumen finansial

  • Instrumen finansial * instrumen finansial










Tdk diproduksi


Aset Finansial

Dengan kewajiban

Tanpa kewajiban

  • Deposito bank

  • Pinjaman

  • Saham & Modal

  • Cadangan asuransi

  • Aset-aset lain

  • Kewajiban lain

  • Emas moneter

  • SDR’s


Aset Non-Finansial


Tdk diproduksi




Tak berwjd





  • Goodwill

  • Leases

  • Tanah

  • Aset subsoil

  • Hutan yg tdk

  • dibududayakan

Tak berwujud


  • Software

  • Entertainment

  • Mineral Exploration

  • Rumah tinggal

  • Bangunan lainnya

  • M&E

  • Aset yg dibudidayakan (buah2an, ternak)


  • Login