PENCATATAN DALAM SISTEM NERACA NASIONAL
This presentation is the property of its rightful owner.
Sponsored Links
1 / 106

Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA PowerPoint PPT Presentation


  • 244 Views
  • Uploaded on
  • Presentation posted in: General

PENCATATAN DALAM SISTEM NERACA NASIONAL. Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA. Siklus Proses Produksi. Enterpreneur (Management) Organization and Development of Other Three Factors. Land Natural Resources. Production Goods and Services. Capital

Download Presentation

Bahan Perkuliahan SNN-PDB SEKOLAH TINGGI ILMU STATISTIK – JAKARTA

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

PENCATATAN DALAM SISTEM NERACA NASIONAL

Bahan Perkuliahan SNN-PDB

SEKOLAH TINGGI ILMU STATISTIK – JAKARTA


Siklus proses produksi

Siklus Proses Produksi

Enterpreneur

(Management)

Organization and

Development of

Other Three Factors

Land

Natural

Resources

Production

Goods and

Services

Capital

Machinery,

Factories

Labor

Human Efforts

And Skills


Kompensasi atas faktor produksi

Merupakan sumber daya alam yang paling dasar

  • “Sewa tanah”

  • harga atas peng-gunaan tanah

  • penghargaan yang diterima oleh pemilik atas keterlibatannya dalam proses produksi

“Tanah”

Merupakan faktor produksi terpenting

“Upah dan gaji”

- penerimaan pekerja atas kontribusinya dalam berbagai proses produksi

“Tenaga kerja”

faktor produksi yang dibuat manusia dari sumber daya alam

“Bunga”

- Termasuk penerimaan atas faktor kepemilikan kapital (deviden,royalti & properti lainnya)

“Kapital”

“Keahlian/

Kewira-usahaan”

“Keuntungan”

penerimaan “keuntungan” wira usaha atas layanan serta resiko usahanya, bahkan kemungkinan kehilangan bisnisnya (rugi)

Manajemen

Kompensasi Atas Faktor Produksi


Arus siklus dari pendapatan

Rumahtangga

Pengeluaran

rumahtangga

Pengeluaran rumahtangga (Output)

Pemerintah

Perantara keuangan

Rest of the world

Pendapatan rumahtangga (Input)

Perusahaan

Arus Siklus dari Pendapatan

ke faktor

Pembayaran


Proses pencatatan dalam snn

SISTEM

NERACA

NASIONAL

SISTEM

PENCATATAN

TRANSAKSI

TRANSAKSI

EKONOMI

TINDAKAN

EKONOMI

PELAKU

EKONOMI

ARUS

EKONOMI

  • Moneter & non

  • moneter (barter)

  • Pasar & non pasar

  • Dengan & tanpa

  • pihak lain

  • Motif ekonomi

  • Resiko ekonomi

  • Neraca ber-jalan

  • Neraca aku-mulasi

  • Neraca akhir tahun

  • Cakupan

  • Acrual & cash/ tunai

  • Pencatatan ganda & quadraple

  • Penilaian &

  • penyesuaian

KLASIFIKASI

  • Perubahan :

  • Harga

  • volume

  • Perilaku

  • Jenis institusi

  • Unit Institusi

ARUS

LAINNYA

PENGARUH

NON MANUSIA

TINDAKAN

NON EKONOMI

  • Gempa bumi

  • Banjir

  • Motif non ekonomi/sosial

  • Resiko non ekonomi/sosial

Lainnya :

peristiwa politik

Proses Pencatatan Dalam SNN

TINDAKAN MANUSIA


Perangkat data snn indonesia

Domestik

(Internal Acc)

ROW

(External Acc)

Tabel I-O

Ekspor/

Impor

PDB

Tabel S-U

Factor Income

SNSE

Current Transfer

Matrik

PMTB

Capital Transfer

NAD

Pinjaman

Perangkat Data SNN Indonesia

Neraca B & J

Neraca Prod.

Neraca P P

Neraca K

Neraca F

B/S

B/S

akhir

awal


Output data nasional

N.Lingkungan

SNNI

Central framework

N.Pariwisata

SEAFA

Gender

PDB

Tabel I-O

Matriks

S & U

  • APC & MPC

  • ICOR & ICVAR

  • Stok Kapital

  • Labor Productivity

SAM

Lap.

Usaha

Penggunaan

NAD

Pendapatan

Output Data Nasional

Input data

- …

- …

PDB

N. Energi


Prinsip pencatatan snni 5a

:

Pelaku ekonomi

Actors

:

Perilaku/aktivitas ekonomi

Activities

:

Arus/flows atau posisi/stocks

Actions

:

Keterkaitan

Accounts

Sistem pencatatan dgn

format neraca

:

Articulated

Prinsip Pencatatan SNNI – “5A”


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

ACTOR(PelakuEkonomi) &INSTITUTION(Unit Ekonomi)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Domestik

Rest of the Word

(Luar Negeri)

RT

LNPRT

Pemerintah

Korporasi

(Non-Residen)

(Residen)

Actors

(pelaku-pelaku ekonomi)


Klasifikasi unit ekonomi

Klasifikasi Unit Ekonomi

  • Dua cara untuk mengklasifikasikan aktor ekonomi:

    • Unit Institusi  Sektor

    • Establishmen  Industri

  • Nasional

    • Neraca-neraca yang dikumpulkan dari unit institusi residen dikelompokkan ke dalam sektor dan sub-sektor

    • Tingkat propinsi dan kabupaten


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Unit institusidanSektor


Unit institusi

Unit Institusi

Unit Institusi:

Entitasekonomi yang atasnamanyadapatmemilikiasetdankewajiban, terlibatdalamaktivitasekonomi, danbertransaksidenganentitas lain

Karakteristik:

  • Berhakmemilikibarangdanaset, sehinggadapatmelakukanpertukaranmelaluiaktivitastransaksidengan unit institusi lain

  • Dapatmemutuskanuntukterlibatdalamaktivitasekonomi, sehinggabertanggungjawabdandapatmempertanggung-jawabkantindakanya di depanhukum

  • Hal di atasmenimbulkankewajiban, danatasnamanyadapatmelakukankomitmenatasdasarkepercayaanataukontrak formal

  • Memilikisatu set neracalengkap, ataucatatankeuangan yang memadaidarisudutekonomimaupunhukumgunadapatmenyusunneraca


Unit institusi lanjutan

Unit Institusi (lanjutan…)


Unit institusi lanjutan1

Unit Institusi (lanjutan…)

  • Rumahtangga

    • Individurumahtanggaterdiridariindividuataukelompok individuyang tinggalbersamadalamsuatubangunantempattinggal. Secarabersamamerekamengelola pendapatandankekayaansertamengkonsumsi barang dan jasa utamanyakelompokmakanandanperumahan

    • Institusirumahtanggamerupakankelompok individuyang tinggal di rumah sakit, panti jompo, biara, dan tempatsejenisuntuk periode cukuplama. Secarakeseluruhanindividuataukelompokindividu yang ada diperlakukan sebagai satuunit

  • Entitas legal atau sosial

    • Entitasyang diakuiolehhukumataumasyarakat, dankeberadaanyaterpisahdari individu atau entitas lain yangmengendalikan. Entitasini bertanggung jawab atas tindakan ekonomi yang diambil meskipun otonominyadibatasi olehinstitusi lain. Entitasiniterdiridariunit korporasi, lembaga non-profit, danpemerintah


Sektor institusi

SektorInstitusi: kumpulan unit yang mempunyaifungsi, tujuandanperilaku yang samadidalamperekonomian

SektorInstitusi

SektorInstitusiterdiri:

  • Korporasi (Finansial & Non-finansial)

  • Unit Pemerintah

  • Lembaga Non-profit Pelayan RT/LNPRT

  • Rumahtangga


1 korporasi

  • Entitas legal yang menentukantujuankegiatandalammemproduksibarangdanjasauntukmemenuhipermintaanpasar, yang nantinyaakanmenjadisumberkeuntunganatauperolehanfinansial (gain) bagipemiliknya.

  • Merupakanusahakolektif yang dimilikiolehparapemegangsaham yang mempunyaiotoritasatauhakmengaturmanajemensecarakeseluruhan

1. Korporasi


1 korporasi lanjutan

  • Dibentuksecara legal (Terdaftar) sesuaidenganhukumnegarabersangkutan

  • Terlibatdalamproduksibarang-barangpasar

  • Kepemilikanberkaitandenganpemiliksahamsecarakolektif

  • Mempunyaisatu set neracasecaralengkap

  • Memilikiasetsendiri yang berbedadenganasetpemilik

  • Termasukkuasikorporatdankoperasi

1. Korporasi (lanjutan….)


1 korporasi lanjutan1

1. Korporasi (lanjutan….)

  • Mampumenghasilkanlaba/keuntunganfinansial lain untukpemilik

  • Diakuisebagaibadanhukumygterpisahdrpemilikygmenikmatilaba

  • Hanyaterlibatdalamproduksiuntukkeperluanpasar


2 unit pemerintah

Institusi yang didirikanmelaluiprosespolitikdanmemilikikekuasaandibidanglegislatif, eksekutifmaupunyudikatifatas unit-unit lainnya yang beradadisuatuwilayahtertentu.

2. Unit Pemerintah

  • Establishment/ kel. Estab. pemerintahdenganproduksejenisdibawahmanajemenumumharusdiperlakukansebagaikorporasikuasibila:

    • Unit tsbmenetapkanharga output ygsignifikansecaraekonomi

    • Dikeloladandioperasikandgncaraserupakorporasi

    • Memilikisatu set neracalengkapsehinggadptdiukurdandiidentifikasisecaraterpisah


2 unit pemerintah lanjutan

2. Unit Pemerintah (lanjutan….)

  • Peranpemerintah(dibentukdari unit-unit pemerintahan)

    • Mengorganisir/mendanaiproduksibarang/jasa non-pasar

    • Jasa individual & kolektifuntukrumahtanggadankomunitas

    • Terlibatdalamdistribusi/redistribusipendapatandankekayaanmelaluiPerpajakandan transfer lain


3 unit lembaga non profit

3. Unit Lembaga Non-Profit

Merupakan entitas legal maupun sosial yang didirikan dengan tujuan untuk menghasilkan barang dan jasa yang bukan merupakan sumber bagi pendapatan, keuntungan atau perolehan finansialnya

Khususnya ditujukan bagi unit-unit kegiatan yang dibangun, dikontrol serta dibiayai oleh mereka sendiri


3 unit lembaga non profit lanjutan

3. Unit Lembaga Non-Profit (lanjutan…..)

  • Lembaga Non-profit yang MelayaniRumahTangga (LNPRT)

    • Entitas legal yang fungsiutamanyamemberikanjasa non-pasarkepadarumahtangga

    • Sumberdanautamaadalahdarisumbanganrumahtanggadaninstitusi lain

    • BagiandariLembaga Non-Profit (LNP), LNP lain yang melayanipemerintahdankorporasi


3 unit lembaga non profit lanjutan1

Org. formal informal ygdibentukolehperorangan, kel. masy, pemerintah, atauduniausahadalamrangkamenyediakanjasasosialkemasy., khususnyabagiangg. maupunkel. masy. tertentutanpaadanyamotivasimemperolehkeuntungan

3. Unit Lembaga Non-Profit (lanjutan….)


4 rumahtangga

4. Rumahtangga

  • Individuataukelompokindividu yang tinggalbersamadalambangunantempattinggal, dimanamerekamengumpulkansebagianatauseluruhpendapatandankekayaansertamengkonsumsibarangdanjasasecarabersamaterutamamakanandanperumahan.


4 rumahtangga lanjutan

  • CakupanRumahTangga

    • Terdiridariorangataukumpulanorang yang masaksatudapur (pengaturanmakan yang sama)

    • Termasukusahatdkberbadanhukum

    • Pemasoktenagakerja; utamanyakonsumenakhir

    • Termasukaktivitasoperasionalrumahtangga

    • Termasuksektor informal

4. Rumahtangga (lanjutan….)


Unit institusi residen

Unit InstitusiResiden

  • Suatuunit institusi menjadiresidensuatuwilayah ekonomi,jikamenjadipusat kepentingan ekonomi yang dominan di wilayahbersangkutan

  • Konsepresidendanwilayah ekonomi dirancangguna memastikan bahwa setiap unit institusi residenmasuk dalam satu wilayah ekonomi

  • Penggunaan wilayah ekonomi sebagai cakupanstatistikdapatdiartikanbahwasetiap anggota kelompok perusahaan afiliasi merupakanresiden perekonomian di mana diaberada, bukan berdasarkan lokasi keberadaankantorpusat


Unit institusi residen lanjutan

  • Unit institusidiklasifikasikansebagaiResiden, jikahanyamempunyaipusatkepentinganekonomidinegaratersebutyang ditandaidengan

  • Lokasitempatproduksiberadadidalamnegara

  • Bermaksuduntukmelakukanaktivitasnyasecaraberkelanjutandenganjangkawaktu yang tidakterbatasatauterbatas (paling sedikit 1 tahun)

  • Untukindividu, adalahlokasirumahnyadanbukantempatdiabekerja

Unit InstitusiResiden (lanjutan…..)


Unit institusi residen lanjutan1

  • Untukusahatidakberbadanhukum, residensamadenganpemilikusaha

  • Untukkorporasidanlembaga non-profit, tempatmerekamendaftarkanusaha (secarakonsitusi legal)

  • Pemiliktanahdanbangunanpadasuatunegara, selaluberadadinegaratersebut

  • Kedutaan, konsulatdankeberadaanestablismenmiliterdiluarnegeri, dianggapsebagairesiden

  • Lembagainternasional (PBB, dsj) adalahbukanresiden (non-residen)

Unit InstitusiResiden (lanjutan…..)


Unit institusi residen lanjutan2

Unit InstitusiResiden (lanjutan…..)

  • PemegangasetdanTransaktor.

  • Korporasi and kuasikorporasi

    • Non-finansial

    • Finansial

  • PemerintahanUmum

  • Rumahtanggadanusaharumahtanggatidakberbadanhukum

  • Lembagaswasta non-profit yang melayanirumahtangga

    -----------------------------

  • LuarNegeri


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Enterprise, EstablismentdanIndustri


Enterprise

  • Unit-unit institusi yang terlibatdalamkegiatanprosesproduksi, seperti:

    • Korporasi

    • Institusi non-profit

    • Usaha bukan-korporasi

  • Secarasimultanberarti

    • Terlibatdalamkegiatanproduksi yang berbeda-beda

    • Menghasilkanberbagaimacam/jenisprodukbarangdanjasa

Enterprise


Cakupan enterprise

Cakupan Enterprise


Enterprise dan establisment

Enterprise danEstablisment

  • Data yang diperolehdarisuatuestablismenmeliputi:

  • Item dalam neraca produksi dan neraca pendapatan yang diciptakan;

  • Data jumlahdan jenispekerja, sertajam kerjanya;

  • Perkiraan stok modal non-finansial, dan sumber daya alam yang digunakan;

  • Perkiraan perubahan stokdan PMTB yang dilakukan


Industri

Industri

  • Kelompokbeberapaestablismenygterlibatdalamkegiatanekonomi yang samaatausejenis

  • Tidakadakorespondensilangsung (one-to-one point) antaraaktivitasdenganproduk (ISIC & CPC).


Enterprise establisment dan industri

Enterprise, EstablismentdanIndustri


Manfaat dan inti analisis

ManfaatdanIntiAnalisis

  • “Institusi”sebagaidasardalampenyusunan diagram rangkaianneracasecaralengkap

  • “Establismen”sebagaidasaruntukanalisisproduksi, Supply and Usedan Input-Output


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Activities

(KegiatanEkonomi)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Produksi

Konsumsi

Akumulasi

Perilaku Ekonomi

Activities

(kegiatan ekonomi)


Activities

Activities

  • Tipikaldariberbagaimacamaktivitasekonomi

  • Aktivitas yang disetarakandalamsatusatuanmoneter

  • Dasarbagipenyusunanneraca


Aktivitas ekonomi

AktivitasEkonomi

  • Proses produksi

  • Distribusi dan redistribusi pendapatan

  • Konsumsi

  • Akumulasi/Investasi


Aktivitas ekonomi lanjutan

AktivitasEkonomi (lanjutan…..)

  • Produksi: Perusahaan menggunakantenagakerjauntukmemproduksibarangdanjasadanmenjualnyakerumahtanggadanpenggunalainnya

  • Distribusi: Pendapatandaripenjualanbarangdanjasatersebutdigunakanuntukmembayarupahpekerjadankeuntunganbagipemilikperusahaan.

  • Konsumsi: Barang-barang (nondurabledandurable) danjasa-jasa yang dibeliolehrumahtangga; Pemerintahmembelibarangdanjasa-jasanondurable

  • Akumulasi: Barang-barang yang dibeliuntukdigunakandimasa yang akandatang – investasitetapuntukusaha, investasitetaptempattinggal (rumahtangga), daninventori


Aktivitas produksi

AktivitasProduksi

  • Untukmenghasilkanbarangdanjasasecaraspesifikdgnmengkombinasiberbagaisumberdayatersediasepertiperalatan, teknikindustri, tenagakerja, produk (bahanbaku)

  • Merupakansatuaktivitastunggal yang dalamprosesmenghasilkanberbagaiproduksecarahomogeensepertibuah, bahanmakanan, hasiltenun, mobil


Aktivitas produksi lanjutan

AktivitasProduksi (lanjutan)

  • Aktivitasproduksimerupakanproses yang dilakukan di bawah kendali dan tanggung jawab unit institusi yang menggunakan input tenaga kerja, modal, barang dan jasa untuk menghasilkan output barang dan jasajenis lain

  • Klasifikasi aktivitasproduksi yang digunakan SNA adalah ISIC (Rev.4), yang terdiri dari 21 bagian, 88 divisi, 238 grup, dan 419 kelas

  • TipedariAktivitasproduksi

    • Aktivitasutama (pincipal activities)

    • Aktivitastambahan (secondary activities)

    • Aktivitaspenunjang (ancillary activities)


Aktivitas utama

  • Aktivitasutamadari unit produsenmerupakanaktivtasgunamenghasilkannilaitambahmelebihinilaitambahaktivitas lain yang dilakukandalam unit yang sama.

  • Aktivitasutamasuatu enterprise terdiridariprodukutamadanprodukikutanyaituproduk yang diproduksibersamadenganprodukutama.

  • Output aktivitasutamamencakupbarangataujasa yang mampudisediakanuntuk unit lain, meskipundapatdigunakanuntukkonsumsisendiriataupembentukanmodlsendiri.

AktivitasUtama


Aktivitas sekunder

  • Aktivitassekundermerupakanaktivitas yang dilakukanoleh unit produsendisampingaktivitasutamanya, output aktivitassekunderjugadisediakanuntuk unit lain diluar unit produsen yang bersangkutan.

  • Nilaitambah yang dihasilkanolehaktivitassekunderharuslebihsedikitdariaktivitasutama.

  • Output dariaktivitassekundermerupakanproduksekunder. Banyakprodusenmenghasilkansetidaknyabeberapaproduksekunder.

AktivitasSekunder


Aktivitas tambahan

  • Merupakanaktivitas yang bersifatinsidentialdarisuatu enterprise.

  • Aktivitasinidifasilitasisecaraefisienoleh enterprise tetapitidakmenghasilkanbarangdanjasauntukdipasarkan.

AktivitasTambahan


Hubungan antara pelaku dan perilaku ekonomi

Produksi

Konsumsi

(akhir)

Akumulasi (Kapital)

Korporasi

X

Rumah tangga*)

Lembaga nirlaba

X

X

Pemerintah

Luar negeri

HubunganAntaraPelakudanPerilakuEkonomi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Actions(Tindakan)


Actions tindakan ekonomi

Actions(TindakanEkonomi)

  • Bagaimanamengukurnilaitindakan ?

    - Posisi/stok (stocks)

    - ArusEkonomi (flows)

  • Tipetindakan ?

    - Aset (harta)

    - Kewajiban (tanggungan)

  • Bagaimanacaramerekamnya ?


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Flows

(Arus Ekonomi)

Stocks

(Posisi)

  • Produksi

  • PMTB

  • Konsumsi

  • Penduduk

  • PMTB

  • Aset

  • Penduduk

  • Hutang

  • Tabungan

Actions

(tindakan)


Arus flows dan posisi stocks

Arus (Flows) danPosisi (Stocks)

  • ArusEkonomi (Flows) :Untukmengkuantifikasitindakanekonomiataumengukurperubahannilaiekonomiselamaperiodewaktutertentu

  • Posisi (Stocks) : Untukmengukurperistiwaakibatkegiatan/ tindakanekonomipadawaktusebelumatausesudahkejadianekonomi.

    Hubungannya…

    Stokterbentukkarenaprosesakumulasiarusdariwaktu-waktusebelumnyaditambahdenganarusselamaperiodepencatatantersebut


Arus flows dan posisi stocks1

Arus (Flows) danPosisi (Stocks)

  • Posisi(Stocks)sumberdayadiukurpadasuatutitikwaktutertentu

  • ArusEkonomi(Flows) dicatatdalambentukTansaksi (perubahankepemilikan) barang & jasa, aset & kewajiban, selamaperiodewaktutertentu


Arus ekonomi flows

  • Mencerminkanpenciptaan, transformasi, pertukaran, transfer atauhilangnyanilaiekonomi

  • danmelibatkanperubahanpadakomposisi volume ataunilaiaset/kewajibaninstitusitertentu

  • Dilakukanolehinstitusidalamperekonomiandandiukurolehsektorinstitusiatauperekonomiansecarakeseluruhan

ArusEkonomi(Flows)


Contoh flows dan stocks

Contoh : Flows danStocks

  • Kemakmuran (Wealth), Pendapatan (income) danpengeluaran (expenditure)

  • Kapital (modal) danInvestasi

  • HutangPemerintah

  • Kerugiananggaran

  • Aset/Harta

  • Tabungan

  • Inventori/Persediaan


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Stokaset & kewajiban

(1 January 2005)

Arus

Arusekonomibarang & jasa, pendapatan, aset, kewajiban, dst.,

(1 Jan 2005- 31 Dec 2005)

Flows

Stokasetdankewajiban

(31 December 2005)


Jenis arus ekonomi

JenisArusEkonomi

  • Dengan perjanjian para pihak terkait

    • Antar unit institusi

    • Didalam unit institusi yang beroperasi dengan kapasitas berbeda

  • Arus lain – perubahan nilai aset dan kewajiban tanpa transaksi

    • Perubahan volume

    • Tingkat dan struktur harga


Jenis transaksi arus ekonomi

JenisTransaksi (ArusEkonomi

  • Barang dan Jasa: menunjukkan asal dan penggunaan

  • Distributif (Pendapatan): arus pendapatan yang dihasilkan oleh produksi atas faktor; dan redistribusi pendapatan

  • Instrumen Finansial: akuisi neto dari aset finansial atau pemenuhan kewajiban

  • Akumulasi lain: perubahan kuantitas atau nilai aset & kewajiban (penemuan/pengurangan aset sub-soil, pembelian tanah, keuntungan, kerugian karena perubahan harga


Transaksi moneter

TransaksiMoneter

  • Transaksi dengan mitra (“lawan”)

    sesuatu untuk sesuatu

  • Transaksi tanpa mitra (“lawan”)

    sesuatu untuk nihil

Jasa tenaga kerja

kompensasi

Pemberian


Transaksi non moneter

Transaksi Non-Moneter

  • Barter

  • Penyusutan modal tetap

  • Pemberianupahdalambentukbarang

  • Transfer dalambentukbarang


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Acccounts(Neraca)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Transaksi

Berjalan

Akumulasi

Balance

sheet

Produksi

Kapital

Awal Tahun

Pendapatan & pengeluaran

Finansial

Akhir

Tahun

flows

stocks

Accounts

(neraca)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

SistemPencatatan

Format SajianNeraca

  • Neraca “T” : terbagidalam 2 lajur, kiridankanan.

    Lajurkananmerekamberbagaitransaksisumber (source) sedanglajurkiritransaksipenggunaan (uses).

  • Tabel : rekapitulasineraca “T”

  • Matriks:

    Penyajianneracadalambentukposisisejumlahbaris (m) dansejumlahkolom (n), gunanyauntukmenunjukanhubungantransaksisecaralangsung


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Neraca “Tipe T”

NERACA : X


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Format Tabel


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Format Matriks


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Neraca

Tiga jenis neraca pokok :

  • Neraca transaksi berjalan (Current accounts)

  • Neraca Akumulasi (Accumulation accounts)

  • Neraca Akhir tahun (Balance sheets)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaTransaksiBerjalan

(Current Accounts)

  • Neraca Produksi

  • Neraca Pendapatan & penggunaan

    • Distribusi primer pendapatan

    • Distribusi sekunder pendapatan

    • Redistribusi pendapatan (inkind)

  • Neraca penggunaan pendapatan


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaProduksi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaProduksi

Item utama

  • Output (keluaran)

  • Konsumsi (biaya) antara

  • Konsumsi barang modal tetap

    (penyusutan/depresiasi)

  • Nilai tambah (Value added)

    Bruto/Neto


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NilaiTambah (BrutodanNeto)

Nilai Tambah Bruto

  • Output

    (minus) biaya/konsumsi antara

    Nilai tambah Neto

  • Output

    (minus) biaya/konsumsi antara

    (minus) konsumsi barang modal tetap


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaPendapatandanPenggunaan


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

ProduksidanDistribusi Primer

Output :

(-)input bahanbaku = PDB

(-)input barang modal tetap= PDN

(-)input tenagakerja = Surplus usaha &

Pendapatancampuran

(+)Pendapatanpemilikan, neto = PendapatanNasional


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

RedistribusidanDistribusiSekunder

Transfer sosial

  • Bentuk tunai

  • Bentuk barang

    Butir (item) penyeimbang: Pendapatan/penerimaan disposabel Nasional/Regional


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaPenggunaanPendapatan

Pendapatan disposabel

(-)Pengeluaran konsumsi aktual

= Tabungan (bruto/neto)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaAkumulasi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaAkumulasi

(Accumulation Accounts)

  • Neraca kapital

  • Neraca finansial

  • Perubahan lain dalam aset

  • Neraca revaluasi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

NeracaAkhirTahun

(Balance Sheets)

  • Opening balance sheet

  • Closing balance sheet


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Articulated

(Keterkaitan)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Double entry

(pencatatan ganda)

Quadraple entry

(pencatatan 4 x)

Articulated

(keterkaitan)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

PencatatanDua Kali

(Double Entry)

  • Prinsip pencatatan ganda, sebagaimana dalam akuntansi perusahaan

  • Setiap transaksi dicatat dua kali

    • Sekali sebagai Sumber (atau perubahan pada kewajiban)

    • Sekali sebagai Penggunaan (atau perubahan pada aset)

  • Oleh karenanya Transaksi total pada kedua sisi harus sama


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

PencatatanEmpat Kali

(Quadraple Entry)

  • Dalam neraca nasional yang terdiri dari semua sektor institusi, prinsip pencatatan empat kali dipakai karena sebagian besar transaksi melibatkan dua sektor institusi, sehingga pencatatan dua kali (untuk satu sektor) menjadi empat kali.


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

KeterkaitanAntarNeraca

N P

1

N P

2

N P

3

N P

4

Konsolidasi

N P

N P P

1

N P P

2

N P P

3

N P P

4

Konsolidasi

N P P

N K

1

N K

2

N K

3

N K

4

Konsolidasi

N K

N F

1

N F

2

N F

3

N F

4

Konsolidasi

N F

Int. Ner.

1

Int.Ner.

2

Int.Ner.

3

Int.Ner.

4

Neraca

Agregasi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

PrinsipAkuntansi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Prinsip/TatacaraPencatatan

  • Penilaian, (yang mana ?)

    - Arus (Flows) dan

    - Stok (Stocks)

  • Waktu pencatatan (bilamana ?)

    - Akrual (accrual) dan

    - Tunai (cash)

  • Pengelompokkan (mengapa ?)

    - Neto

    - Konsolidasi

    - Agregasi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Basis Akrual

  • Sistem ini merekomendasikan untuk selalu menggunakan basis akrual dalam setiap pencatatan transaksi

  • Akuntansi akrual mencatat arus pada saat nilai ekonominya terbentuk akibat dari proses transformasi, pertukaran, transfer atau punah

  • Sistem akuntansi akrual hanya dapat diaplikasikan untuk mencatat arus “non-moneter” saja


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Basis Akrual Vs Basis Tunai

  • Basis Akrual

    • Penerimaan dicatat apabila barang sudah dijual atau jasa digunakan

    • Pengeluaran dicatat apabila biaya untuk menghasilkan penerimaan sudah dikeluarkan

  • Basis Tunai

    • Penerimaan dicatat apabila sudah diterima secara tunai

    • Pengeluaran dicatat apabila sudah terjadi pengeluaran secara tunai


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

WaktuPencatatan

  • Periode akuntansi diantara 2 (dua) waktu pencatatan balance sheet

  • Banyak kegiatan mengawali aktivitasnya pada suatu periode akuntansi dan berakhir pd periode akuntansi berikutnya

  • Dua tipe pendekatan pengukuran yang digunakan untuk mengukur perfoma tersebut adalah

    “basis akrual vs basis tunai”


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

Pengelompokkan

(Grouping)

  • Neto

  • Konsolidasi

  • Agregasi


Consolidated sna matrix with sub accounts

Consolidated SNA Matrix with Sub-Accounts


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

AturanAkuntansiDuaSisiNeraca

  • SisikanandariNeracaberjalanadalahSumber (transaksi yang menambahjumlahnilaiekonomidarisektor, misalnya output dalamneracaproduksi)

  • SisikiridariNeracaberjalanadalahPenggunaan (transaksi yang menguranginilaiekonomidarisektor, misalnyakonsumsiantarapadaneracaproduksi)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

AturanAkuntansiDuaSisiNeraca

  • SisikanandariNeracaAkhirTahun (NAT) adalahKewajibandanKekayaanbersih (selisihantaraasetdankewajiban)

  • SisikiridariNeracaAkhirTahunadalahAset

  • DenganmembandingkanduaNeracaAkhirTahunpadatahun yang berurutankitadapatmengetahuiperubahandalamKewajiban and KekayaanBersihdanperubahanAset


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

AturanAkuntansiDuaSisiNeraca

  • Neracaakumulasidan NAT merupakanneraca yang terintegrasisecarapenuh, SisikanandariNeracaakumulasiadalahPerubahanpadakewajibandanKekayaanbersih

  • SisikiridariNeracaAkumulasidisebutPerubahanpadaAset

  • Dalamkasustransaksipadainstrumenfinansial, iniberkaitandenganpemenuhankewajiban (neto) danakuisisiasetfinansial (neto)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

AturanAkuntansi - Rerouting

  • Rerouting transactions

    • Iuranpemberikerja/majikanuntukjaminansosial (Pemberikerjamembayarsahamuntukiuranjaminansosialkepadadanajaminansosial)

    • Pemberikerja (untukpekerja) jaminansosial

  • Partitioning transactions

    (peminjammembayaramortisasibulananhutangnya)

    amortisasi > cicilanhutang (pokok) + bunga


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

AturanAkuntansi - Penilaian

  • Transaksidinilaiatasdasarhargasebenarnya yang disetujuiolehpelakutransaksi

  • Nilaiatasdasarhargapasar

    • Nilaididasarkanpadahargadipasar

  • Untuktransaksinon-pasarpenilaiandibuatmenurutBiaya yang terjadi


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

AturanAkuntansi – PencatatanTransaksi

  • Nilaiprodukapakahmenurut

    • Hargadasar

    • Hargaprodusen

    • Hargapembelian

  • Impordanekspordicatatpadanilaiperbatasan (border) (fob)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

AturanAkuntansi – PencatatanTransaksi

  • Pencatatantransaksibruto

  • Pencatatantransaksineto

    P = Penggunaan S = Sumber

P

S

P

S

Transfer Kapital yang dibayar

Transfer Kapital yang diterima

Transfer Kapital neto yang diterima

Pencatatan Neto

Pencatatan Bruto


Pencatatan transaksi

Pencatatan Transaksi

  • Barang dan Jasa * barang dan jasa

  • Barang dan Jasa * pendapatan

  • Barang dan Jasa * instrumen finansial

  • Pendapatan * instrumen finansial

  • Instrumen finansial * instrumen finansial


Indikator kinerja ekonomi

INDIKATORKINERJA EKONOMI


Indikator kinerja ekonomi lanjutan

INDIKATOR KINERJA EKONOMI (lanjutan)


Indikator kinerja ekonomi lanjutan1

INDIKATOR KINERJA EKONOMI (lanjutan)


Indikator kinerja ekonomi lanjutan2

INDIKATOR KINERJA EKONOMI (lanjutan)


Klasifikasi aset secara umum

KLASIFIKASI ASET SECARA UMUM

Finansial

Aset

Diproduksi

Non-Finansial

Tdk diproduksi


Klasifikasi aset aset lanjutan

KLASIFIKASI ASET-ASET (lanjutan)

Aset Finansial

Dengan kewajiban

Tanpa kewajiban

  • Deposito bank

  • Pinjaman

  • Saham & Modal

  • Cadangan asuransi

  • Aset-aset lain

  • Kewajiban lain

  • Emas moneter

  • SDR’s


Klasifikasi aset lanjutan

KLASIFIKASI ASET (lanjutan)

Aset Non-Finansial

Diproduksi

Tdk diproduksi

Tetap

Inventori

Berharga

Tak berwjd

Berwujud

Material

Logam

mulia

  • Goodwill

  • Leases

  • Tanah

  • Aset subsoil

  • Hutan yg tdk

  • dibududayakan

Tak berwujud

Berwujud

  • Software

  • Entertainment

  • Mineral Exploration

  • Rumah tinggal

  • Bangunan lainnya

  • M&E

  • Aset yg dibudidayakan (buah2an, ternak)


Bahan perkuliahan snn pdb sekolah tinggi ilmu statistik jakarta

S E L E S A I


  • Login