Tau dataset analysis
This presentation is the property of its rightful owner.
Sponsored Links
1 / 6

Tau Dataset Analysis PowerPoint PPT Presentation


  • 58 Views
  • Uploaded on
  • Presentation posted in: General

Tau Dataset Analysis. PHF tau phosphorylation and ubiquitination sites (isoform 2). P. MAEPR QEFEV MEDHAGTYGL GDR K DQGGYT MHQDQEGDTD AGLKESPLQT PTEDGSEEPG SETSDAKSTP TAEDVTAPLV DEGAPGK QAA AQPHTEIPEG TT AEEAGIGD TPSLEDEAAG HVTQAR MVSK SKDGTGSDDK KAKGADGKTK

Download Presentation

Tau Dataset Analysis

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Tau dataset analysis

Tau Dataset Analysis


Tau dataset analysis

PHF tau phosphorylation and ubiquitination sites (isoform 2)

P

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT

PTEDGSEEPG SETSDAKSTPTAEDVTAPLVDEGAPGKQAA AQPHTEIPEG

TTAEEAGIGDTPSLEDEAAGHVTQARMVSK SKDGTGSDDK KAKGADGKTK

IATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPK SGDRSGYSSP

GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPM

PDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSK CGSKDNIKHV

PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRV

QSKIGSLDNI THVPGGGNKK IETHKLTFRE NAKAKTDHGA EIVYKSPVVS

GDTSPRHLSN VSSTGSIDMVDSPQLATLADEVSASLAKQG L

P

P

U

U

P

P

P

P

P

P

P

P

P

P

U

P

P

U

P

U

U

U

U

P

U

P

P

U

U

P

P

P

P

P

BLUE = sequence coverage; = phosphorylation; = ubiquitination

P

U


Ubiquitin sequence

Ubiquitin Sequence

6 11

MQIFVKTLTG KTITLEVEPS DTIENVKAKI

18

QDKEGIPPDQ QRLIFAGKQL EDGRTLSDYN

63

IQKESTLHLV LRLRGG


Tau dataset analysis

K6: [email protected] K11: [email protected]

K48: [email protected] K63: [email protected]

For LysC digestion, we didn’t identify any ubiquitation sites since LysC doesn’t cut on R.


  • Login