1 / 19


  • Uploaded on

TEORI STIMULUS-RESPON DOLARD MILLER. Danang Setyo Budi Baskoro. Konsep melalui percobaan binatang. Teori Stimulus Respon Dolard & Miller. Struktur Kepribadian. Perkembangan kepribadian. Dinamika Kepribadian. Perangkat innate & primary process. ketidaksadaran.

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about ' TEORI STIMULUS-RESPON DOLARD MILLER' - kaveri

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript



DanangSetyo Budi Baskoro



Teori Stimulus Respon

Dolard& Miller





Perangkat innate

& primary process



(training situation)












Merasakesakitan, tikusberusahamelompatipagar

Tikusdiberisuara + sengatlistrik










Percobaan 2

Tikuspunyarespondaripercobaan 1  mendengarsuarabel = meloncatpagar


# Beldibunyikandantikusmulaimeloncatipagar. Saattikusberhasil

loncat, beltetapbersuara.

# Krnbeltetapbersuara, makatikustetapmeloncat-loncathinggaia


# Saattuasditekan, makasuara






Kejutlistrik (US) dipasangkandenganbel (CS) menimbulkanrespon internal (remot) dalamhalinirasa sakit. Eksperimen yang dilakukanberkali-kali mengakibatkanrasa sakit (remot) yang berulang pula sehinggapadaakhirnyarasa sakit (remot) itumenjadistimulus drive (SD) untukmemunculkansuatuperilaku (Remot), yaitumenyeberangipagar.

Prosesperubahan(remot) menjadi(SD) disebutsebagaiinternal emotional sequence. Keinginanuntukmenghilangkanrasa sakit (remot) menjadidorongan (SD) untukmemunculkanrespontertentu (Remot) sehingga rasa sakitituhilang


US (KejutListrik)

SD (drive)

R emot

Internal emotional sequence


CS (suara)


Tikusmelompatipagarkarenadiberilistrik = primary drive

Tikusmelompatpagarkarenamendengarsuarabel = secondary drive

Primary Drive

Secondary Drive

Struktur kepribadian

  • Strukturkepribadiansebagianbesardibentukoleh habit, (hubungan S-R).

  • Kepribadianterdiridari habit-habit

  • Habit dapatberupaperilaku yang overt ataupun yang covert

  • Bentuk habit terbentuksesuai dg peristiwaygdialami

  • Habit bisadigantikan dg habit baruakibatpengalamandikemudianhari

Dinamika kepribadian

  • Motivasi (Drives)

  • Prosesbelajar

  • Prosesmental yglebihtinggi

  • Model konflik

  • ketidaksadaran

1 motivasi drives
1. Motivasi (Drives)

# Masing-masingindividumengembangkan drive sekunder yang tugasnyauntuk


# Namunpadamasyarakat modern, dorongan drive skundernampakbanyakyg

menggantikanperan drive primer. Drive sekundertsbseperti, kecemasan, rasa malu,

keinginanmenyenangkanorang lain

Dalamkehidupanmanusia, drive ygmenggerakkanperilakubukansajakrn

reward primer akantetapiperistiwa-peristiwaygmulanyanetral, namun

seringterpasangkan dg reward primer.

Contoh :

1. Senyumanibumerupakan reward sekunderbagibayi, krndiasosiasikan dg

Pemberianmakandanbentukpemeliharaan lain ygmendatangkankenikmatandan


2. Uangdiasosiasikanolehorang-orang dg kebutuhansandang, pangan, papan.

Reward Sekunder

Reward Primer

2 the learning process
2. The learning process…

Padaprosesbelajar, individuharuswant something, notice something, do something, get something.

  • Drive

    adalah stimulus yang cukupkuatuntukmengaktivasisuatuperilakunamuntidakmenentukanbentukperilaku yang akandimunculkan. Secondary drive biasanyauntukmemenuhi primary drive. Seseorangygtakutpresentasimengasosiasikanbahwa audience memberinya rasa tidaknyaman/ rasa sakit.

  • Cue

    adalah stimulus yang menentukansecaratepatrespon yang akanditampilkan. Ex : responthdsuarakeras, responthdkata-kataramah. Namunindividuakanberbedadlmmerespontdkhanya pd cue ygbedavariasinya, nmnjgbedaintensitasnya. Ex : responthdkata-kataramah dg nada keras, akanberbedajika dg nada ygpelan/kalem.

  • Respon

    adalah segala aktivitas yang dilakukan oleh organisme. Suatu respon biasanya bisa didahului oleh respon lain terlebih dahulu (initial hierarchy of response).

  • Reinforcement

    Reinforcement menurut Dollard dan Miller sebagai drive peredadorongan(drive reduction). Reduksi drive menjadisyaratmutlakdari reinforcement.

3 model konflik
3. Model Konflik…

  • Gradient of approach, kecenderunganutkmendekatitujuansemakinkuatsaatindividusemakindekat dg tujuanitu.

  • Gradient of avoidance, kecenderunganmenjauhisuatu stimulus negatifsemakinkuatketikaindividusemakindekat dg stimulus itu.

  • Perubahantingkatmenjauhilebihtajamdaripadaperubahantingkatmendekati

  • Meningkatnyadoronganygdiasosiasikan dg mendekatataumenjauhakanberakibatmeningkatnyabobotperubahantingkat pd umumnya

  • Jikaada 2 responygbersaingmakayglebihkuatakanmuncul. (Aproach-Avoidance, Aproach-Aproach, Avoidance-Avoidance).

Aproach-Avoidance Conflict

suatukeadaandimanamuncul stimulus untukmendekatidanmenjauhiobyekatausituasisecarabersamaandanmemilikiintensitas yang sama.

Contohnya, seseorangmerasabingungantaramelaporkankecurangan yang dilakukanolehtemannyakarenaituadalahsesuatu yang benar (approach) denganketakutanakandikucilkandaripergaulankarenadianggaptidaksetiakawan (avoidance).

Aproach-Aproach Conflict

suatukeadaandimanaindividudihadapkanpadasituasidimanaiaharusmemilihsalahsatudariduaobyekatausituasi yang sama-samadiinginkan.

Contohnya, seorangmahasiswadiharuskanmemilihsatudariduatema yang diinginkannyasebagaibahanpenelitian.

Avoidance-Avoidance Conflict:

suatukedaandimanaindividudihadapkanpadaduaalternatif yang sama-samatidakmenguntungkan.

Contohnya, sepasangsuamiistridihadapkanpadapilihanuntukberceraiatautetapmenikahdemianak-anakmereka. Jikamerekabercerai, adakemungkinanakanmengganggukestabilanemosianak-anakmereka, namunjikamerekatetapmenikah, merekamerasatidakbahagia.

4 proses mental yg lebih tinggi
4. Proses Mental yglebihtinggi

  • Generalisasi stimulus

  • Reasoning

  • Bahasa (ucapan, pikiran, tulisan, danbahasatubuh)

  • Secondary drive

5 ketidaksadaran
5. Ketidaksadaran

Dollard dan Miller memandangpentingfaktorketidaksadarantetapiberbedadengan Freud. Dollard dan Miller membagiisi-isiketidaksadaranmenjadidua, yaitupertama, ketidaksadaranberisihal yang tidakpernahdisadari (seperti stimuli, drive danresponyang dipelajari) jugaapa yang dipelajarisecara nonverbal dan detail dariberbagaiketrampilanmotorik. Kedua, berisiapa yang pernahdisadaritetapitidakbertahandanmenjaditidakdisadarikarenaadanyarepresi.

1 innate equipment


1. Innate equipment

Kapasitasperilaku yang terbatas yang dimilikiseorangbayi. Meliputirespon yang ternatasterhadapsuatu stimulus tertentuserta primary drive yang dimilikinya. Refleksspesifik(specific reflexes), Refleksbawaan yang hirarki(innate hierarchies of response), Dorongan primer (primary drive)

2. KonteksSosial

Dollard dan Miller menekankansalingketergantunganantaratingkahlakudenganlingkungansosiokultural. Bagi Dollard dan Miller, prinsip–prinsipbelajarnyadapatditerapkanlintasbudaya. Dollard dan Miller yakinbahwatingkahlakuorangdipengaruhiolehmasyarakatnya.

3 situasi pembelajaran
3. Situasipembelajaran

  • Bagaimana habit terbentukmenurutteoristlumus-responDolard& Miller..?

  • Apaygdimaksud primary drive dan secondary drive? berikancontohnya..!!

  • Apaygdimaksud primary reward dan secondary reward? berikancontohnya..!!
