100 likes | 192 Views
Can Halorabdus utahensis secrete proteins? A. Malcolm Campbell. Halorabdus utahensis habitat. Halorabdus utahensis habitat. 28% w/v NaCl in Gunnison Bay excludes many species Brine shrimp reproduce in low salt areas of Gunnison Bay
E N D
Can Halorabdus utahensis secrete proteins? A. Malcolm Campbell
28% w/v NaCl in Gunnison Bay excludes many species • Brine shrimp reproduce in low salt areas of Gunnison Bay • Brine shrimp feed on algae with cell walls of cellulose and other • complex sugars • Shrimp in main body of Gunnison Bay die • Brine flies inhabit the shoreline http://ut.water.usgs.gov/greatsaltlake/
Translation with Secretion Albert Bolhuis. 2004. Phil. Trans. R. Soc. Lond. B. Vol. 359: 919–927.
Translation with Secretion Signal peptidase I (EC 3.4.21.89) Albert Bolhuis. 2004. Phil. Trans. R. Soc. Lond. B. Vol. 359: 919–927.
Translation then Secretion Tat proteins use protein domain of SRRXFLK to be targeted to be exported Figure from Sonja-Verena Albers, Zalán Szabó and Arnold J. M. Driessen. 2006. Nature Reviews: Microbiology. VOLUME 4.
Translation then Secretion Tat proteins use protein domain of SRRXFLK to be targeted to be exported Figure from Sonja-Verena Albers, Zalán Szabó and Arnold J. M. Driessen. 2006. Nature Reviews: Microbiology. VOLUME 4.
Translation then Secretion Tat (twin arginine targeting proteins) use protein domain of SRRXFLK to be targeted to be exported ✔cellulase (glycosyl hydrolase family 5) MTDPDRPPTGDREASQSNTTTGGEGPSRRTFLK… ✔ phage tail protein, P2 protein I family MTRRTNDTGEVDEKPSSGAEQQGSNDSTGSRDPSRRDFLK... ✔ candidate polyfunctional acetylxylan esterase-B-xylosidase-a-L-arabinofuranosidase, glycoside hydrolase Family 43 protein and Carbohydrate Esterase Family 6 protein – MTRRTNDTGEVDEKPSSGAEQQGSNDSTGSRDPSRRDFLK… ✔ Endoglucanase MTHNNPDDDSTARRTTESTESPSTAGIASASRRDFLK... ✔ Exocellobiohydrolase A/1,4-beta-cellobiohydrolase A MTHNNPDDDSTARRTTESTESPSTAGIASASRRDFLK ✔ Cellulase (glycosyl hydrolase family 5)./Fibronectin type III domain MTDEATESIEASATDHTDETAGNRKDPGLTSSRRTFLG...
+ =