Algorithms in Computational Biology
This presentation is the property of its rightful owner.
Sponsored Links
1 / 10

Algorithms in Computational Biology PowerPoint PPT Presentation


  • 88 Views
  • Uploaded on
  • Presentation posted in: General

Algorithms in Computational Biology. Tanya Berger-Wolf Compbio.cs.uic.edu/~tanya/teaching/CompBio January 13, 2006. Outline. What is computational biology? Computational Biology vs Bioinformatics Why is computational biology important? CompBio and other fields Topics in CompBio.

Download Presentation

Algorithms in Computational Biology

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Algorithms in computational biology

Algorithms in Computational Biology

Tanya Berger-Wolf

Compbio.cs.uic.edu/~tanya/teaching/CompBio

January 13, 2006


Outline

Outline

  • What is computational biology?

  • Computational Biology vs Bioinformatics

  • Why is computational biology important?

  • CompBio and other fields

  • Topics in CompBio


What is computational biology

What is Computational Biology?

  • No standard definition!

  • Our definition: computational techniques for biological problems

    • Data acquisition, management and representation (bioinformatics)

    • Pattern analysis and data mining (bioinformatics)

    • Data analysis and optimization

    • Using bio data to solve other problems (medicine, public policy, etc.)

  • Computational biology touches all parts of computer science

    • Databases

    • Data streaming

    • HPC and systems

    • Networking

    • Algorithms

    • Privacy and security

    • Image processing

    • Visualization

http://www.colorbasepair.com/what_is_bioinformatics.html


Why is compbio important

Why is CompBio Important?

  • Biology perspective

    • More and more biological information is available => need for effectively accessing and using the information

    • As more detailed information is available different questions can be asked (models of evolution) => requires new math

  • Computer science perspective

    • Excellent application domain

    • Poses special computational challenges

    • Brings computer science closer to scientific discovery

  • Currently growing …


The growing field of compbio

The Growing Field of CompBio

  • Research: Universities are expanding research programs in bioinformatics/compbio

  • Education: New degree programs are being launched

  • Industry: Pharmaceutical industry has a great interest in bioinformatics

  • Many job and funding opportunities


Compbio and other fields

CompBio and Other Fields

Computer Science

Biology

Information

Management

Biochemistry

Molecular

Biology

Bioinformatics/CompBio

Theoretical CS

Machine Learning

Data Mining

Biophysics

Numerical

Computing

Applied Mathematics & Statistics


Topics in bioinformatics

Topics in Bioinformatics

Text Mining

Genomics

Proteomics

Transcriptomics

Biology Literature

…In this paper, we report the discovery of a new gene that affects DNA reproduction in …

Gene expression & regulation

Genes

Proteins (Function)

DNA Sequences

Microarray data

Protein Sequences

AATTCATGAAAATCGTATACTGGTCTGGTACCGGC

TGAGAAAATGGCAGAGCTCATCGCTAAAGGTA

TCTGGTAAAGACGTCAACACCATCAACGTGTC

ACATCGATGAACTGCTGAACGAAGATATCCTG

TTGCTCTGCCATGGGCGATGAAGTTCTCGAGG

MKIVYWSGTGNTEKMAELIAKGIIESGKDV

DELLNEDILILGCSAMGDEVLEESEFEPFIE

KVALFGSYGWGDGKWMRDFEERMNGYG

PDEAEQDCIEFGKKIANI


Sample topic 1 sequence alignment

Sample Topic 1: Sequence Alignment

Multiple sequence alignment of 7 neuroglobins using clustalx


Sample topic 2 population genetics

Sample Topic 2: Population Genetics

?

Brothers!

?


Take away messages

Take Away Messages

  • Computational Biology is a growing field

  • Many job/funding opportunities

  • Many open problems to be solved

  • Actually can do something good for the humanity? – Nah!


  • Login