1 / 23

TRANSLASI - PowerPoint PPT Presentation

  • Uploaded on
  • Presentation posted in: General

TRANSLASI. Sintesis Protein. Translasi. Sintesis protein terjadi di ribosom dg 4 tahap utama : aktivasi , inisiasi , elongasi & terminasi

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'TRANSLASI ' - harvey

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript


Sintesis Protein


  • Sintesis protein terjadidiribosom dg 4 tahaputama : aktivasi, inisiasi, elongasi & terminasi

  • Substansi2 ygterlibatantara lain : ribosom, tRNA, aminoacyl-tRNA-synthetase, mRNA, protein faktor, ion2 anorganik (Mg2+, K+, NH4+) & guanosintriphosphate (GTP)

  • tRNAadalah RNA ss dg 75-85 nukleotida, bertanggungjawabdlmprosespengenalankodonpada mRNA.


  • Asam amino bergabungdengantRNAmelaluiguguskarboksil AA tsb dg gugus 3’OH tRNAmelaluiikatan ester  tRNAdikatakanbermuatan

  • Prosesaktivasiinimemerlukanenergiygdidapatdrprosesadenilasimenggunakan ATP

  • Asam amino yang teradenilasiakandiikatkanpadaujung 3’ tRNA (biasanyaberupasekuen CCA) & membentukaminoasiltRNA.

Proses adenilasi aktivasi
Prosesadenilasi - Aktivasi


  • Proses inisiasi melibatkan perakitan komponen translasi yaitu :

    • 2 sub unit ribosom

    • mRNA

    • aminoasil tRNA pertama (the charged tRNA with the 1st amino acid)

    • GTP sbg sumber energi

    • faktor inisiasi (initiation factor = IF) yang membantu perakitan kompleks inisiasi


  • Ribosomterdiriatas 3 site :

    • A site : utkmasuknyaaminoasiltRNA (kecualiaminoasiltRNApertamaygberupafmet-tRNA)

    • P site : tempatpeptidiltRNAdibentuk

    • E site : exit site of the uncharged tRNA


  • Inisiasitranslasidimulaidenganasosiasiribosom sub unit kecil & besar

  • IF1 memblok site A (agar hanyafmet-tRNAdptterikat pd P site & tdkadaaminoasiltRNA lain ygdptterikat pd A site selamainisiasi)

  • IF3 memblok E site

  • IF2 terikat pd fmet-tRNA & membantuterikatnyatRNA pd ribosom sub unit kecil


  • 61 buah kodon dpt digunakan utk pbtk ikatan peptida & 3 kodon : UAA, UAG & UGA merupakan tanda STOP (tdk dpt utk mengkode pbtk asam amino & bfgs sbg tanda berhentinya pbtk rantai polipeptida) & kodon START adalah : AUG  metionin!



  • AminoasiltRNAbergerakmenujukebagian A denganbantuan elongation factor (EF)

  • Ikatanpeptidaterbentukdenganasam amino sebelumnyaygadadibagian P

  • Peptidabergerakkeluarkompleksribosommelaluibagian E


  • Stlh EF-Tu menempatkan aminoasil-tRNA pd site A, GTP akan terhidrolisis mjd GDP. GDP dari EF-Tu akan melepaskan diri dr ribosom  faktor kedua EF-Ts berikatan dg EF-Tu dg melepas GDP.

  • GTP baru masuk kedlm kompleks EF-Tu-EF-Ts dg melepas EF-Ts & mulailah kompleks EF-Tu-GTP mengambil aminoasil-tRNA baru utk proses elongasi.


  • Secara normal, aminoasiltdkdptterikat pd kodon UAA, UAG & UGA (kodon STOP) & seltdkmempunyaitRNA dg antikodonygkomplementer dg 3 kodon stop tsb.

  • Faktor lain selainkodon stop ygdptmenghentikantranslasiadalahfaktor protein (release factor) RF-1 dan RF-2. RF-1 dptmengenalkodon UAA & UAG sedangkan RF-2 mengenal UAA & UGA.

  • Ikatanantara RF dg kodon stop akanmengaktifkanpeptidiltransferaseygmenghidrolisaikatanantarapolipeptida dg tRNA pd site P. RantaipolipeptidaakanmeninggalkanribosomdiikutitRNA & ribosomakanmengalamidisosiasi.

Monosistronik polisistronik
Monosistronik & polisistronik

  • Molekul mRNA eukariottdratas rangkaian2 nukleotidaygdptditranslasi & tdkdapatditranslasi. Polipeptidaplgbanyakhanyatdratas 500 asam amino ygdptditranslasi, dikenalsbg mRNA monosistronikkrnhanyamampumbtktdklbhdr 1 mcmpolipeptida.

  • Molekul mRNA prokariotikdptmentranskripsilebihdr 1 macampolipeptida, dsbt mRNA polisistronik. Contoh : mRNA polisistronikE. colipbtktriptofan dg pjg 7000 rangkaianbasadptmbtk 5 mcmenzim.

  • Login