Supplementary Figure 1.
This presentation is the property of its rightful owner.
Sponsored Links
1 / 6

Supplementary Figure 1. Amino acid sequence alignment of the S locus F-box genes. PowerPoint PPT Presentation


  • 32 Views
  • Uploaded on
  • Presentation posted in: General

Supplementary Figure 1. Amino acid sequence alignment of the S locus F-box genes. MdFBX1 1 ----------------MSLVCESETPEDQLVEILSWLRPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTCILLNR--------------CQ 70

Download Presentation

Supplementary Figure 1. Amino acid sequence alignment of the S locus F-box genes.

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Supplementary figure 1 amino acid sequence alignment of the s locus f box genes

Supplementary Figure 1. Amino acid sequence alignment of the S locus F-box genes.

MdFBX1 1 ----------------MSLVCESETPEDQLVEILSWLRPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTCILLNR--------------CQ 70

MdFBX2 1 ----------------MSQVRECETPEDKVVEILSKLPPKSLIRFKCIRKSWCTIINSPSFVAKHLRISMDNKLSSTTCILLNR--------------CQ 70

MdFBX3 1 ----------------MSQVSETETPEDRVVAIMSKLPPKSLMRFKCIRKSWCTVINSPSFVAKHLSNSVDNKFSSSTCILLNR--------------SQ 70

MdFBX5 1 ----------------MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHLSNTVDNKFSSFTCILFNR--------------CQ 70

MdFBX6 1 ----------------MSQLHETETPEDKVVEILSRLPPKCLMRFKCIRKSWCTLINSPSFVAKHLNNSMDNKLSSSTCILLNR--------------SQ 70

MdFBX7 1 ----------------MSQVRESETPEDRVVEILSRLSPKSLLRFKCIRKSWCTLVNSPSFVAKHLSNSLENKLSSSTCILLNR--------------SQ 70

MdFBX8 1 ----------------MSQEHESEAPEDRVVEILSRLPPKSLMRFKCIRNSWCTLINSPRFVAKHINNSVDNKLSSSTCILLHR--------------SQ 70

MdFBX9 1 ----------------MSQVCESETPEDRVVETLSRLPPKSLMRFKCICKSWCTLINSLSFVAKHLNNSMDNKLSSSTCILLSR--------------SQ 70

MdFBX10 1 ----------------MSQVRECETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

MdFBX11 1 ----------------MSQVHENETLEDRVVEILSRLLPKSLMRFKCIRKSWCTLINSPSFVAKQLSNSVDNKFSSSTCILLNR--------------SQ 70

MdFBX12 1 ----------------MSQVHDSETLEDRIVEILSRLPPKSLMRFKCIRKPWCTLINSPSFVAKYLSNSVDNKLSSSTCILLNR--------------TQ 70

MdFBX13 1 -------------------MLENITPEDRMIEILSKLPAKSLTRFKCIRKSWCTLINSPSFVAKHLNNSADSKLSSSTCILVNH--------------SQ 67

MdFBX14 1 MSQVRKSETLKDRVTEMTQVRESETPEVRVAEILSRLPPKSLMRFKCIRKSWCTAINNPSFTAKHLSNSVDNKFSSSTCILLHR--------------SH 86

MdFBX15 1 ----------------MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHLSNTVDNKFSSCTRILFNR--------------CQ 70

MdFBX16 1 ----------------MFQVRESETPENSVVETLSRLPPKSLMRFKCIRKSWCTLINSPSFVAKHFNNSMDNKLSSSTCILLSR--------------SQ 70

MdFBX17 1 ----------------MSQVRESETPEDRMVGILSRLSPKSLLRFKCIRKSWCTLINSPSFVAKHLSNSLDNKLSSSTCILLNR--------------SQ 70

MdFBX18 1 ----------------MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

MdFBX19 1 ----------------MSHVRQSKTPEDRVIEILSRLPPKSLMRFKCLHKSWFSLINSLSFVDKHLSNSVDNKLPSSTCILLNR--------------SQ 70

MdFBX20 1 ---------MLNKTVEMSQVHDSETPEDRVVEILSRLPPKSLMRFKCIHKSWCTLINSPSFVAKYLSNSVDNKLSSSTCILLNR--------------TQ 77

MdSFBB3-alpha 1 ----------------MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNR--------------SQ 70

MdSFBB3-beta 1 ----------------MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNR--------------SQ 70

MdSFBB9-alpha 1 ----------------MSQVRESETPEDQVVEILSRLPPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTGILLNR--------------CQ 70

MdSFBB9-beta 1 ----------------MSQVRESETLEDKVVEILSKLPPKSLMRFKCIRKSWCTIINSPSFVAKHLNNSMDYKLSSTTCILLNR--------------CQ 70

PpSFBB1-gamma 1 ----------------MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBB2-gamma 1 ----------------MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBB3-gamma 1 ----------------MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBB4-alpha 1 ----------------MSQVHESETPEDKVVEILSRLPPKSLIRFKCVRKSWCTIINSPSFVAKHLSNTVDNKFSSFTCILFNR--------------SQ 70

PpSFBB4-beta 1 ----------------MTQVRESETPEDRVAEILSRLPPKSLMRFKCIRKSWGTIINNPSFMAKHLSNSVDNKFSSSTSILLHR--------------SQ 70

PpSFBB4-gamma 1 ----------------MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBB5-alpha 1 ----------------MSQVHESETPQDKVVEILSRLTPKSLMRFKCVHKSWCTIINSPSFVAKHLSNTVDDKFSSFTCILFNR--------------SQ 70

PpSFBB5-beta 1 ----------------MTQVCESETLEDRMAEILSRLPPKSLMRFKCIRKSWCTVINNPSFMAKHLSNSVDKKFSSSTCILLHR--------------SH 70

PpSFBB5-gamma 1 ----------------MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBB6-gamma 1 ----------------MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSADNKLSSSTCILLNC--------------SQ 70

PpSFBB7-gamma 1 ----------------MSQVCESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBB8-gamma 1 ----------------MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBB9-gamma 1 ----------------MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PpSFBBk-gamma 1 ----------------MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC--------------SQ 70

PdSFB1 1 -------------------MAFILRKKEILIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVGTHLHRNVTGHAQAYLLCLHHP---------------- 65

PdSFBa 1 -------------------MTFTPRKKEILIDILVRLPAKSLVRFLFTCKVWSDLISSSSFVSTHLNRNVTKHAHVYFLCFHHP---------------- 65

PdSFBd 1 -------------------MTFALRKKEILIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVGTHLHRNVTGHAQAYLLCLHHP---------------- 65

PdSFBf 1 -------------------MAFTLRKKEIMIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVSTHLHRNVRKHAHVYLLCLHHP---------------- 65

PcSFB9 1 -------------------MTFTLRKNEILIDILARLPTKSLVRFLCTCKSWSDLIGSSSFVSTHLHWNVTKHARGYLLCLHHP---------------- 65

PsSFBc 1 -------------------MTVRLRKKEILIDILVRLPAKSLVRFLCTSKSWSDLIGSSSFVSTHLHRNDTIHAHVYLLCLHPS---------------- 65

ParSFBc 1 -------------------MTFTLRKKEILIDILVRLPAKSLIRFLSTCKSWSDLIGSSIFVSTHLCRNVTKHTHVYLLCLHHP---------------- 65

PavSFB2 1 -------------------MIFALRKKETLIDILVRLPSKSLVRFLFTCKSWSDLICSSSFVSTQLHRNVTKHAQIYLLCLHHP---------------- 65

PavSFB5 1 -------------------MTFSLRKEEILIDILVRLPAKSLVRFLCTCKSWSDLVGSSSFVSTHLHRNITKHAHVHLLCLHHP---------------- 65

PavSFB6 1 -------------------MTFTLRKKDILIDILVRLPAKSLVRFLCTCKSWIDLIGSSSFISTHLHRNATKHTHVYLLCLHHP---------------- 65

PavSFB9 1 -------------------MTFTLRKNEILIDILARLPTKSLVRFLCTCKSWSDLIGSSSFVSTHLHWNVTKHARGYLLCLHHP---------------- 65

PavSLFL1-S1 1 -----------------------MWEEMALRRILPRLPSKSLIRFKSVRKSWYTLINNSTFVENHLSNSMHNKLSTCILFNRFV--------------QS 63

PavSLFL1-S2 1 -----------------------MWEEMALRRILPRLPSKSLIRFKCVRKSWYNLINSPTFVENHLSNSMHNKLSTCVLFNRFV--------------QR 63

PavSLFL1-S4 1 -----------------------MWEEMALRRILPRLPSKSLMRFKCVRKSWYTLINNPTFVENHLSNSMHSKLSTCVLFSRFV--------------QR 63

PavSLFL1-S6 1 -----------------------MWEEMALRRILPRLPSKSLMRFKCVRKSWYTLINNPTFVENHLSNSMHSKLSTCVLFSHFV--------------QS 63

PavSLFL2-S4 1 ------------------MATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDQHLSTSMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 82

PavSLFL3-S4 1 -----------------MTYFCKMTEEMEVQ-ILARLPPKSLMRFKCVCNSWHALLKNPHFVAKHLHLYNYQPSSTCILFKRSV--------------LS 68

PmSFB1 1 -------------------MTFTLGKKEILIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVRTHLDRNVTKHAHVYLLCLHHP---------------- 65

PmSFB3 1 -------------------MTFRRGKKEILIDILVRLPAKSIVRFTCTCKSWSDLIGSSSFVSTHLRRNVTKHAHVYLLCLHHQ---------------- 65

PmSLF7 1 -------------------MTFSLRKKEILIDILVRLPAKSLVRFLCTCKSWGDLIGSSSFVSIHLNRNVTKHAHVYLLCLHHP---------------- 65

PmSLFL1-Sf 1 -----------------------MWEEMALRHILPRLPSKSLMRFRCVRKSWYILINNPTFVENHLSNSMQSKLSTCVLFSRFV--------------QS 63

PmSLFL2-S1 1 --------------MMREMATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDHHLSISMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 86

PmSLFL2-S7 1 --------------MMREMATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDHHLSISMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 86

PmSLFL2-Sf 1 --------------MMREMATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDHHLSISMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 86

PmSLFL3-S7 1 ---------------------------MEVQ-ILARLPPKSLMRFKCVCKSWHALLNNPHFVAKHLHLYNNQPSSTCVLFKRSV--------------LS 58

PmSLFL3-Sf 1 -----------------MTYFYKMTEEMEVQ-ILARLPPKSLMRFKCVCKSWHALLNNPHFVAKHLHLYNNQPSSTCVLFKRSV--------------LS 68

PhSLFv 1 ----------------MANGILKKLPEDLVFLILLTFPVKSLLRLKCISKAWSILIQSTTFINRHINRKTN---TKAEFILFKR---------------- 65

PiSLF1 1 ----------------MANDILMKLPEDLVFLVLLTFPVKSLLRFKCISKAWSILIQSTTFINRHVNRKTN---TKDEFIIFKR---------------- 65

PiSLF2 1 ----------------MANGILKKLPEDLVFLILLTFPVKSLMRFKCISKAWSILIQSTTFINRHINRKTN---TKDEFILFKR---------------- 65

PiSLF3 1 ----------------MANGVLKKLPEDLVCLILLTFPVKSLMRFKCISKTWSILIQSTTFINRHVNRKTN---TKDEFILFKR---------------- 65

PiSLF3A134 1 ---------------------MKELPQDVVIYIFVMLPVKSLLRSKCTCKTFCHIIKSSTFINLHLNHTTN---FNDELVLLKR---------------- 60

PiSLFL1 1 ---------------MTTRRMMNKLPEDVVIYILFRLPVKSLLRFKCTSKAWYTLILSDTFVKLHHNHATA---TKEEFILFIR---------------- 66

PiSLFL2b 1 ---------------MMLDGIMKHLPEDVAMYILSRFPVKALLRFKFISKTWSTLIESSTFINIHLNRATT---TNNEFLLFSR---------------- 66

PiSLFL2d 1 ------------------MTAMKKLPIDVVINILFRLPVKSLTRFKCVTKSWYSLIQSANFINRHLNRATA---VKDEFILFKR---------------- 63

Pa17 1 ----------------MPNGILKKLPEDLVFLILLTFSVKSLMRFKCISKAFSILIQSTTFINRHVNHEIN---KEDEFILFKR---------------- 65

Pa19 1 ----------------MANGILKKLPEDLVFLILLTFPVKSLLRFKCISKAWSILIQSTTFINRHINRKTN---TKAEFILFKR---------------- 65

PaF1 1 ----------------MANGILKKLPEDLVFLILLTFPVKSLMRFKCISKSWSFLIQSTGFINRHVNRKTN---TKDEFILFKR---------------- 65

NaDD1 1 ----------------MVGGIIKAIPEDVVIYVLIRLPVKSIMRFKCTSKTLYILIRSTSFSNIHLNHTTT---LQDELILFKR---------------- 65

NaDD2 1 ----------------MVDGIMKELPEDLVIYVILMLPVKSLLRLKSSCITFCNIIKSSTFINLHLNRTTN---GKDELILFKR---------------- 65

NaDD3 1 ----------------MVNGSIKKLPEDLVFCMLLRCPVKSLMRFKCISKVWYHFIQSTTFINLHLNRTTS---VENEFILFKH---------------- 65

NaDD4 1 ----------------MVGGIIKAVPEDVVIYVLIRLPVKSIMRFKCTSKTLYILIRSTSFSDIHLNHTTT---SQDESILFKR---------------- 65

NaDD5 1 ----------------MADGMVKKLPKDMLVYIILILPVKSLLRLKCVSKFWYTLLNSSTFVNLRVNRTTT---TNAEIILFKR---------------- 65

NaDD6 1 ---------------MMLDGIMKKLPEDVVIYILSRFSVKSLLRFKFISKSWYTLIQSSTFINVHLNRSTI---TKNEFILFSR---------------- 66

NaDD7 1 --------------MEEVNDQRTKLPYDVMIDIMKRLPAKSVIRIKCVSKTWYYMINSPDFISIHYNYDY----PSKHFIVFKR---------------- 66

NaDD8 1 ----------------MADGIVKKLPKDVVICIILILPVKSLLRFKCVSNSWRTLMQSSTFINLHLNRSTT---INDEIILFKH---------------- 65

NaDD9 1 ------------MIPKMGDGTVEKLPKDVVIYIILRLQVKSLIRFKCVSKTWYILIQSSTFIYLHLSHTTT---SNDELVLFKR---------------- 69

NaDD10 1 -----------------ANGIVKKCPEDILIYVLLRLPLKSLMRFKCVTKTFYTFIQSTTFINLHLNRTTI---TKDECILFKC---------------- 64

AhSLF1E 1 -----------------MMDGRFPR-QDVTSEILLFSSVKSLLRFRLVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR---------------- 62

AhSLF2 1 -----------------MMDRRFPR-QDVISEILLFSSVKSLLRFRCVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR---------------- 62

AhSLF2C 1 --------------MEKIADGHPLG-DDKLIEILLHLPVRSLVRFKCVSISWYNLIRSPTFCNKHFLTSR----RNDSVLLVRR---------------- 65

AhSLF4 1 -----------------MMDGRFPR-QDVTSEILLFSSVKSLLRFRLVSKSWCSLIKSHDFIDNHLLRRQ----TNGNVMVVKR---------------- 62

AhSLF5 1 -----------------MMDGRFPR-QDVISEILLFSSVKSLLRFRCVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR---------------- 62

AmSLFL 1 -----------------MMDGRFPR-QDVINEILLFSSVKSLLRFRCVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR---------------- 62

AT2G34280 1 ---------------------MDLLPYDVVEHILERLDVKSLLNCKSVSKQWRSTIRCRAFQERQLMHRRQS--CNPDVLLVS----------------- 60

. ... .. ... ........ ... .... *. .. . . .. .


Supplementary figure 1 amino acid sequence alignment of the s locus f box genes

MdFBX1 71 VHDFPDRSWKQDVFWSMINLSIDSDKNNLHYDVEDL-NIPFPM-------------EDQDNVELHGYCNGIVCVIVGKNVL-----LCNPATGEFRQLPD 151

MdFBX2 71 VHVFPDRSWKQDVFWSMTNLSIDSDEHNLHYDVEDL-NIPFPM-------------EDQDNVEIHGYCNGIVCVIVGKNVL-----LCNPATREFRQLPN 151

MdFBX3 71 VHVFPDKSWKHEVLWSMINLFNERVARTLYYDVEDL-NIPFPR-------------DDHQHVLIHGYCNGIVCVISGKNIL-----LCNPATREFRQLPD 151

MdFBX5 71 VHVFPDRSWKRDVFWSMINLSIDSDEHNLHYDVEDR-NIPFPI-------------EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151

MdFBX6 71 AHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDL-IIPFPL-------------EDHDFVLIFGYCNGIICVDAGKNVL-----LCNPATREFRQLPH 151

MdFBX7 71 FHIFPDQSWKREILWSMINLSIDSDVHNLHYDVKPL-NIPFPR-------------DDHNPVQIHGYCNGIVCLIEGDNVL-----LCNPSTREFRLLPN 151

MdFBX8 71 TPIFPYDSWKREFFWSMINFSIDSDESNLHYDVEDLTNVPLLQW------------EDHHEVEIHGYCNGIVCVTVGEYFF-----LCNPATGEFSQLPN 153

MdFBX9 71 AHVFPDNSWKPEVFWSMINLSIDSDEHNLHYDVEDL-NIPFPL-------------EGHDFVQIEGYCNGIVCVIAGTSLYLINVLLCNPATGKFRQLPP 156

MdFBX10 71 AHVCPEESWKQEVLWSMINLSIDGDE--LHYDVEDLTNVPFLK-------------DDHHELEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

MdFBX11 71 THVFPDNSWKQEVFWSMINLSIDSDEHNLHYDVEDL-NIPFPL-------------EDHDYVLILGYCNGIVCVTAGKNIL-----LCNPTTREFMRLPS 151

MdFBX12 71 MYVFPDQSWKYETLWSMMNLSNYSDEHNLHYDFKDL-NIPFPM-------------EDHHPVQIHSYCNGIVCVITGKSVR----ILCNPATREFRQLPS 152

MdFBX13 68 PHIFPDKNWKQEVFWSMINISIDSDEHSLHYDVVDL-NIPFPL-------------EDHDFVQIHGYCNGIVCVIVGKKFL-----LCNPATREFMQLPN 148

MdFBX14 87 MPVFPDRSWKREYFWSMINLSHDSDEHNLYYDVEDL-NIQFPL-------------EDHDLVSVHGYCNGIVCLIVGKHAV-----LYNPATRELKQLPD 167

MdFBX15 71 VHVFPDRSWKRDVFWSMINLSFDSDEHNLHYDVEDR-NIPFPI-------------EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151

MdFBX16 71 AHVFPDNSWKPEVFWSMINLSIDSDEHNLHYDVEDL-NIPFPL-------------EGHDFVQIEGYCNGIVCVIAGTSLYLINVLLCNPATGKFRQLPP 156

MdFBX17 71 FHIFPDQSWKREVLWSMINLSSDSDVHNLHYDVKPL-NIPFSR-------------DDHNPVQIHGYCNGIVCLIEGDNVL-----LCNPSTREFRLLPN 151

MdFBX18 71 AHIFPDQSWKQGVLWSVIYLSIDGDE--LHYDIEDLTNVPFLK-------------DDHHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

MdFBX19 71 AHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDL-NIPFPL-------------NDHDFVLIFGYCNGIVCIEAGKNVL-----LCNPATREFRQLPD 151

MdFBX20 78 MHVFPDQSWKYETLWSMMNLSNYSDEHNLQYDFKDL-NIPFPT-------------EDHHPVQIHSYCNGIVCVITGKSVR----ILCNPATREFRQLPA 159

MdSFBB3-alpha 71 AHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDL-NIPFAL-------------KDHDFVLIFGYCNGILCVEAGKNVL-----LCNPATREFKQLPD 151

MdSFBB3-beta 71 AHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDL-IIPFPL-------------EDHDFVLIFGYCNGIVCVDAGKNVL-----LCNPATREFRQLPD 151

MdSFBB9-alpha 71 VHVFSDRSWKQDVFWSMINLSIDSDKNNLYYDVEDL-NIPFPM-------------EDQDNVELHGYCNGIVCVIVGKNVL-----LCNPATGEFRQLPD 151

MdSFBB9-beta 71 VHVFPDRSWKQDVFWSMINLSIDSDEHNLHYDVEDI-NIPFPM-------------EDQDNVELHGYCNGIVCVIVGKNVL-----LCNPATGEFRQLPN 151

PpSFBB1-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

PpSFBB2-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

PpSFBB3-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

PpSFBB4-alpha 71 VHVFADRSWKRDVFWSMINLSIESDEHNLDYDVEDL-NIPFPM-------------EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151

PpSFBB4-beta 71 MPVFPDRSWKREYFWSMINLSHDSDEYNLYYDVEDL-NIQFPL-------------EDHDHVSIHGYCNGIVCLIVGKNAV-----LYNPATRELKQLPD 151

PpSFBB4-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

PpSFBB5-alpha 71 VHVFADRSWKRDVFWSMVNLSIDSDEHNLHYDVKDL-NIPFPM-------------EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151

PpSFBB5-beta 71 MPVFPDGSWKREYFWSMINLSRDSDEHNLYYDVEDL-NVQFPL-------------EDHEHISVHGYCNGIVCLIVGKNAL-----LYNPATRELKQLPD 151

PpSFBB5-gamma 71 AQVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

PpSFBB6-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDTEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVPVDENFF-----LCNPATGEFRQLPD 150

PpSFBB7-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

PpSFBB8-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150

PpSFBB9-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DDPHEVEIHGYCDGIVCITVDENFF-----LCNPATGEFRQLPD 150

PpSFBBk-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK-------------DGPHEVEIHGYCDGIVCVTVDESFF-----LCNPATGEFRQLPD 150

PdSFB1 66 -NFECQRDDDDPYFKEELQWSLFSNVTFEESSKLSHPLGSTEHY------------------VIYGSSNGLVCISDEIMNFDSPIHIWNPSVKKLRTTPI 146

PdSFBa 66 -NFECLVDPDDPCFEQELQWSLFSYETFEQCSELSHPLGSPEPY------------------RIYGSTNGLICISDAILSLESPIHIWNPSVRKLRTLPM 146

PdSFBd 66 -NFECQRDDDDPYFKEELQWSLFSNVTFEESSKLSHPLGSTEHY------------------VIYGSSNGLVCISDEIMNFDSPIHIWNPSVKKLRTTPI 146

PdSFBf 66 -NFERKDDPDDPYVEQEFQWSLFSKETLEECSKLSHPSGSTEHY------------------VIYGSSNGLVCISDEILNFDSPIHIWNPSVKKFRTPPV 146

PcSFB9 66 -DVERQADPDDPYVKQELQWSLFSNETFEECSKLSHPLGSTEHY------------------MIYGSSNGLVCISDEILNFDSPIHIWNPSVRKLRTTSM 146

PsSFBc 66 -NFEWAVDPDDPYVKQELQWSLFSNETFEKCFELRHPLGSTEHY------------------GIYGSSNGLVCISDEILNFDSPIHIWNPSIRKFRTPPM 146

ParSFBc 66 -NFERLVDPNDPYLKKEFQWSLFPKETFEECYKLSHPLGMTEHY------------------GIYGSSNGLVCISDEILNFDSPIHIWNPSVRKFRALPM 146

PavSFB2 66 -NFERNDDPDDPYVKQEFHWSLFSNETFEECSKLSHPLGSTEHY------------------VIYGSSNGLVCISDEILNFDSPLHIWNPSVRKLRTPPI 146

PavSFB5 66 -NVRRQVNPDDPYVTQEFQWSLFPNETFEECSKLSHPLGSTEHY------------------GIYGSSNGLVCISDEILNFDSPILMWNPSVRKFRTAPT 146

PavSFB6 66 -NFERNDDPDDPYVEQEFQWSLFSNETFEECSKLSHPSGSTKHY------------------VIYGSSNGLVCISEEILNFDSPIHIWNPSVKKFRTPPM 146

PavSFB9 66 -DVERQADPDDPYVKQELQWSLFSNETFEECSKLSHPLGSTEHY------------------MIYGSSNGLVCISDEILNFDSPIHIWNPSVRKLRTTSM 146

PavSLFL1-S1 64 DPNPKEKELAFSFLYLRNDYD-DAENN-VNCVVEDIKFPLTSGQ--------FIGLEVIESPSIIGHCDGVICLS----ACS--LVLCNPAINEIKLLPE 147

PavSLFL1-S2 64 DANTGEKELGFSFLYLRNDYD-DAEHN-VNFLVEDIKFPLSSGQ--------YIGLEVIESPYMAGHCHGIVCLS----DSSSNLVLCNPGIKEIKLLPK 149

PavSLFL1-S4 64 DTNSDEKELAFSFLYLRNDYD-DDEHN-VNFVVEDIKSPLSSGR--------FIGLEDVESPSILGHCNGIVCLS----PCSDNLLLCNPGIKEIKLLPK 149

PavSLFL1-S6 64 NTNSDEKELAFSFLYLRNDYD-DDKHN-VNFVVEDIKFPLSSGR--------CIGLEDVESPSILGHCNGIVCLS----PCSDNLVLCNPAIKEIKLLPK 149

PavSLFL2-S4 83 ATLFNPDSDQRDILLSSINLGSLVDDG---LEIENHVVPPPMR-------------GYALSLEIAGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 163

PavSLFL3-S4 69 RTEHNKEELVFTFLNLHNDNESNADHNLINCNVEDLHFPHSMGLKSRGPFIELPGLELGESVHIVGHCDGLFCLS----LYTGELVFYNPAIKEFRVLPQ 164

PmSFB1 66 -NFECAIDPNDPYIEEEVQWSLFSNETFEQCSKLSHPLGSTEHY------------------VIYGSSNGLVCISDEILNFDSPIHIWNPSARKLKTPPI 146

PmSFB3 66 -SFECQVDLDDPYVGQELQWSLFCNETFELCSKLSHPLGSTEHY------------------MIYGSSNGLVCISDEILNFDSPIHIWNPSIRKLRTPPL 146

PmSLF7 66 -NFERQVDPDDPYVEQKFHWSIFSNETFEECSKLSHPLGSTERY------------------GIYGSSNGLVCISDEILNFDSPIHIWNPSVRKLRTPPM 146

PmSLFL1-Sf 64 DANSDEKELAFSFLYLRNDYD-DDEHN-VNFVVEDIKFPLSSGR--------FIGLEDVESPSILGHCNGIVCLS----PCSDNLVLCNPAIKEIKLLPK 149

PmSLFL2-S1 87 ATLFNPDSNQRDILLSSLNLGSLVDDG---LEIENHIVPPPMR-------------GYALSLEISGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 167

PmSLFL2-S7 87 ATLFNPDSNQRDILLSSLNLGSLVDDG---LEIENHVVPPPMR-------------GYALSLEISGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 167

PmSLFL2-Sf 87 ATLFNPDSNQRDILLSSLNLGSLVDDG---LEIENHVVPQPMR-------------GYALSLEISGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 167

PmSLFL3-S7 59 RTEHNKEELVFTFLILRNDNEINADHNLINCKVEDLHFPRSMGLKSRGQFIELPGLELGESVHIVGHCDGLFCLS----LYTGELVFYNPAIKEFRVLPQ 154

PmSLFL3-Sf 69 RTEHNKEELVFTFLILRNDNESNADHNLINCNVEDLHFPRSMGLKSRGQFIELPGLELGESVHIVGHCDGLFCLS----LYTGELVFYNPAIKEFRVLPQ 164

PhSLFv 66 -SIK-DEEEEFINILSFFS-GHDD-VLNPLFPDIDVSYMTSKCD------------CSFN--PLIGPCDGLIALT-DTIIT----IVLNPATRNFRVLPP 142

PiSLF1 66 -SIK-DEQEGFKDILSFFS-GHDD-VLNPLFPDVEVSYMTSKCN------------CTFN--PLIGPCDGLIALT-DSIIT----ILLNPATRNFRLLPP 142

PiSLF2 66 -AIK-DDEEEFINILSFFS-GHVD-VLNPLFPDMDVSYMTSKCD------------CTFN--PLIGPCDGLIALT-DTIIT----IVLNPATRNFRVLPA 142

PiSLF3 66 -AIK-DEQEEFRDILSFLS-GHDD-VLNPLFADIDVSYMTSKCN------------CAFN--PLIGPCDGLIALT-DTIIT----IILNPATRNFRLLPP 142

PiSLF3A134 61 -SFETDEYNFYKSILSFLF-AKKDYDFKPISPDVKIPHLTTTAA------------CICH--RLIGPCNGLIVLT-DSLTT----IVFNPATLKYRLIPP 139

PiSLFL1 67 -TFR-EEPDLWKNVASFIY-CDDNNDHNNLFPDLDLSHLTSSYC------------SIFG--QLIGPCHGLIALS-DSIII----IILNPSTRKYVVLPP 144

PiSLFL2b 67 -SYR-EETEGFKNALSILSCGNDD-DLIHTISDLDLPYLTFTQR------------YLFN--KLVGPCNGLIVLT-DFEII----VLFNPATKIYMLIPP 144

PiSLFL2d 64 -SFK-EQ-EGFRNVMSFLVGGIGEDDLDPISPDVDVPYLSTTYS------------CICH--QLTGPCHGLILLT-DSTNL----VLLNPATRNYRLLPP 141

Pa17 66 -AIK-DEEEEFINILSFFS-GHDD-VLNPLFPDIDVSYMTSKFN------------CTFN--PLIGPCDGLIALT-DSIIT----IILNPATRNFRVLPP 142

Pa19 66 -SIK-DEEEEFINILSFFS-GNDD-VLNPLFPDIDVSYMTSKCD------------CTFT--PLIGPCDGLIALT-DTIIT----IVLNPATRNFRVLPP 142

PaF1 66 -AIK-DEEEEFINILSFFS-GYDD-VLNPLFPDIDVSYMTSNCN------------CTFN--PLIGPCDGLIALT-DTIIT----ILLNPATRNFRLLPP 142

NaDD1 66 -SFK-EEANQFKNVISFLF-GVDDVGFDPFLPDLEVPHLTTDYG------------SIFH--QLIGPCHGLIALT-DTITT----ILINPATRNFRLLPP 143

NaDD2 66 -SFKQEEPNLHKNVLSFLL-SEDTFNLKPISPDVEIPHLTNTNA------------SVFH--QLIGPCNGLIALT-DSLTT----ILFNPTTRIYRLIPP 144

NaDD3 66 -SIK-EDTGEFKNVLSFLS-GHDNGALNPLFPDIDVSYMASNCS------------CTFF--PLIGPCNGLIALT-DTITT----ILINPATRNFRLLPP 143

NaDD4 66 -SFK-EEANQFKNVISFLF-GVDDAGFDPLLPDLEVPHLTTDYG------------SIFH--QLIGPCHGLIALT-DSVQT----VLLNPATRHYRLLPP 143

NaDD5 66 -SFK-EEPNQFRSIMSFLSSGHDNYDLHHVSPDLDGPYLTTTSS------------CICH--RIMGPCHGLITLT-DSVTA----VLFNPGTRNHRLLQP 144

NaDD6 67 -SFR-IETEGFKNVLSIISSDDYN-DLNVVLQDLDLPYLTFTPN------------YHFN--ELVGPCNGLIVLTDDDDII----VLFNPATKNYMLLPP 145

NaDD7 67 -YLEIDA-EESIYYNGKN-----MLSVHCNDDSLKSVAPNTEYL------------DDYIGVNIAGPCNGIVCIG-SYRGI----VLYNPTLREFWELPP 142

NaDD8 66 -SFQ-EEPNKFRSIMSFLSSGQDNDDFYHVSPDLDVPFLTTTSS------------CIFH--RFTGPCHGLVVLT-DKVTA----VLFNPTSRNYRLLQP 144

NaDD9 70 -SYK-EEPNRFKSVLSFLSSGHDDDDLHPVSPDLDMQYMTTSSA------------CTCH--RIIGPCNGLIFLT-DKLNN----VLFNPTTRNYRLLTP 148

NaDD10 65 -SIN-----RYKHVLSFISTKNDGDDLRPMSPDLDMSYLTSFNP------------GIGH--RLMGPCNGLIALT-DKVNA----VLFNPATRHYRLLKP 139

AhSLF1E 63 -YVRTPE-RDMFSFYNINSPELDELLPDLPNPYFKNIKFDYDYF------------YLPQRVNLMGPCNGLICLA-YGDCV----LLSNPALREIKRLPP 143

AhSLF2 63 -YVRTPE-RDMFSFYNINSPELDELLPDLPNPYFKNIKFDYDYF------------YLPQRVNLMGPCNGLICLA-YGDCV----LLSNPALREIKRLPP 143

AhSLF2C 66 -FLRPPEDEDVLSFHDVNSPELEQVAPNLSIPFLKDIRLRYNRP------------YFPEGVTLLGPCNGLLCIT-HAEFL----IFCCPTLREFKRLQP 147

AhSLF4 63 -YVRTPE-RDMFSFYDINSPELDELLPDLPNPYFKNIKFDYDYF------------YLPQRVNLMGPCNGLVCLA-YGDCV----LLSNPALREIKRLPP 143

AhSLF5 63 -YVRTPE-RDMFSFYNINSPKLEELLPDLPNPYFKNIKFDYDYF------------YLPQRVNLMGPCNGLICLA-YGDCV----LLSNPALREIKRLPP 143

AmSLFL 63 -YVRTPE-RDMFSFYNINSPKLEELLPDLPNPYFKNIKFDYDYF------------YLPQRVNLMGPCNGLICLA-YGDCV----LLSNSALREIKRLPP 143

AT2G34280 61 --VADEFYLLKRVHQVMRTLVLGSSVSVRILTPWEDTLYKVCQS----------------------SCDGLICLYNTYASN----IVVNPTTRWHREFPL 132

. . . . . . . ..*... . ........ ..


Supplementary figure 1 amino acid sequence alignment of the s locus f box genes

MdFBX1 152 SSLLLPLP----------------KGRFGLETVFKGLGFGYDCKAKEYKVVRIIENCDCEYSEGEESYYE-------------RILLPHTAEVYTMTTNS 222

MdFBX2 152 SSLLLPLP----------------KGRFGLETTFKGMGFGYDCKTKEYKVVRIIENCDCEYSEDGESYYE-------------RILLPHTAEVYTTTANS 222

MdFBX3 152 SFLLLPSPL---------------GGKFELETDFGGLGFGYDCRAKDYKIVRIIEN--CEYSDDERTYYH-------------RIPMPHTAEVFTMATNY 221

MdFBX5 152 SSLLLPLP----------------TGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSDGKESYIE-------------RILLPYTAEVYTTVANS 222

MdFBX6 152 SCLLLP-PP---------------KGKFELETTFQALGFGYDCNSKDYKVVQIIEN--CEYSDDEQTFHH-------------RIALPHTAEVYTTAANS 220

MdFBX7 152 SCLLVP-HP---------------EGKFELETTFHGMGFGYDCKAKEYKVVQIIEN--CEYSDDGQTYQH-------------CIAYPYTAEVYTTAANF 220

MdFBX8 154 SRLLLPLPRG--------------KGKFGLETTVKGLGFGYDCKAKEYKVVRIIENYDCEYSDGEETYIE-------------HTALPHTAEVYTTTANS 226

MdFBX9 157 SYLLLPSRP---------------QGKFQLESIFGGLGFGYDCKAKDYKVVQIIEN--CEYSDDQQYYYH-------------RIALPHTAEVYTMAANS 226

MdFBX10 151 SCLLLPLPGV--------------KEKFGMETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE-------------HIALPHTAEVYTMAANS 223

MdFBX11 152 SCLLLPSRP---------------KGKFELETVFRALGFGYDCKAKEYKVVQIIEN--SEYSDDERTYYH-------------RIPLPHTAEVYTTAANS 221

MdFBX12 153 SCLLVPSPP---------------EGKFQLETIFEGLGFGYDYKAKEYKVVQIIEN--CEYSDDERRYYH-------------RIALPHTAEVYTTTANS 222

MdFBX13 149 SCLLLP-PA---------------EGKFELDTTFEALGFGYDCKGKEYKVVQIIEN--CEYSDDEQTFNH-------------CTTLPHTAEVYTTVANS 217

MdFBX14 168 SCLLLPSPP---------------KGKFELESSFQGMGFGYDSKAKEYKVVKIIEN--CEYSDYERTFSH-------------RIALPHTAEVYVTTTNS 237

MdFBX15 152 SSLLLPLP----------------TGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSDGKESYIE-------------RILLPYTAEVYTTAANS 222

MdFBX16 157 SCLLLPSRP---------------TGKFQLESIFGGLGFGYDCKAKEYKVVQIIEN--CEYSDDQQYYYH-------------RIALPHTAEVYTMAANS 226

MdFBX17 152 SCLLVP-HP---------------EGKFELETTFHGMGFGYDCKANEYKVVQIVEN--CEYSDDEQTYQH-------------CIAYPYTAEVYTTAANF 220

MdFBX18 151 SCLLLPLPGV--------------KVKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE-------------HIALPHTAEVYTMAANS 223

MdFBX19 152 SCLLLPSPP---------------EGKFELETSFQALGFGYDSNAKEHKVVRIIEN--CEYSDEERTFYH-------------RIALPHTAELYTATANS 221

MdFBX20 160 SCLLLPSPP---------------EGKFQLETIFEGLGFGYDYKAKEYKVVQIIEN--CEYSDDERRYYH-------------RIALPHTAEVYTATANS 229

MdSFBB3-alpha 152 SCLLLPSPP---------------ERKFELETNFQALGFGYDCNAKEYKVVRIIEN--CEYSDDERTYYY-------------RIALPHTAELYTTTANS 221

MdSFBB3-beta 152 SCLLQP-PP---------------KGKFELETTFQALGFGYDCNAKEYKVVRIVEN--CEYSDDEQTFYH-------------RIALPHTAEVYTTAANF 220

MdSFBB9-alpha 152 SSLLLPLP----------------KGRFGLETVFKGLGFGYDCKAKEYKVVRIIENCDCEYSEGEESYYE-------------RILLPHTAEVYTMTADS 222

MdSFBB9-beta 152 SPLLLPLP----------------KGRFGLETTFKGMGFGYDCKSKEYKVVRIIENCDCEYSDDGESYYE-------------RILLPHTAEVYTMTANS 222

PpSFBB1-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB2-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB3-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB4-alpha 152 SSLLLPLP----------------TGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSEGKESYYE-------------RILLPYTAEVYTTAANS 222

PpSFBB4-beta 152 SCLLLPSPP---------------EGKFELESTFQGMGFGYDSKAKEYKVVKIIEN--CEYSDDMRTFSH-------------RIALPHTAEVYVTTTNS 221

PpSFBB4-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB5-alpha 152 SSLLLPLP----------------TGRFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSEGKESYYE-------------RILLPYTAEVYTTAANS 222

PpSFBB5-beta 152 SCLLLPSPP---------------EGKFELESTFQGMGFGYDSKAKEYKVVKIIEN--CEYSDDERTFSH-------------RIALPHTAEVCITTTNS 221

PpSFBB5-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB6-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB7-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB8-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBB9-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PpSFBBk-gamma 151 SCLLLPLPGV--------------KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE-------------HIALPYTAEVYTMAANS 223

PdSFB1 147 STSINIKFS------------------------HVALQFGFHSGVNDYRAVRMLRTNQN----------------------------ALAVEIYSLRTDS 194

PdSFBa 147 TTN-NIEFS------------------------YIDLHFGFHPGVNDYKAVRMMGIDKD----------------------------AFAVEIYSLSTDS 193

PdSFBd 147 STSINIKFS------------------------HVALQFGFHSGVNDYRAVRMLRTNQN----------------------------ALAVEIYSLRTDS 194

PdSFBf 147 STNINMKFS------------------------HVALQFGFHPGVNDYKAVRMMRTNKN----------------------------ALAVEVYSLRTDS 194

PcSFB9 147 STNINIKFS------------------------HVALQFGFHPGVNDYKAVRMMRTNKN----------------------------ALVVEVYSLRTDS 194

PsSFBc 147 STNINIKYS------------------------YVALQFGFHPRVNDYKIIRMMRTNKD----------------------------AFTVEVYSLGTDS 194

ParSFBc 147 STNINIKFS------------------------CVALQFGFHPGVNDYKAVRMMRTNKS----------------------------ALAVEVYSLKRDS 194

PavSFB2 147 STNISIKFS------------------------HVALQFGFHPEVNDYKVVRMMRTNKN----------------------------TLAVEVYSLRRDR 194

PavSFB5 147 STNINLKFA------------------------YVALQFGFHHAVNDYKVVRMMRTNKD----------------------------ALAVEVYSLRTDS 194

PavSFB6 147 STNINIKFS------------------------HVALQFGFHPGVNDYKAVRMMRTNKN----------------------------ALAVEVYSLKTDS 194

PavSFB9 147 STNINIKFS------------------------HVALQFGFHPGVNDYKAVRMMRTNKN----------------------------ALVVEVYSLRTDS 194

PavSLFL1-S1 148 SCLPDWWD--------------------------CAVGFGYDPKSKDYKVSRIATYQAEI--DG--------------------LIPPPRVEIYTLSTDS 199

PavSLFL1-S2 150 SCLPDWWG--------------------------CAVGFGYDPKSKDYKVSRIASYQAEIYGDG--------------------LIPRPRVEIYTLSTDS 203

PavSLFL1-S4 150 SGLPDWWG--------------------------CAVGFGYDPKSKDYKVSRIASYQAEI--DG--------------------LIPPPRVEIYTLSTDS 201

PavSLFL1-S6 150 SGLPDWWG--------------------------CAVGFGYDPKSKDYKVSRIASYQAEI--DG--------------------LIPPPRVEIYTVSTDS 201

PavSLFL2-S4 164 SCILLPPRVPRQVEENEDDDYYEEDDDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH-----------------------PSKVEVYSLAADT 240

PavSLFL3-S4 165 SCLENAFS--------------------------CTLGFGYDPKRKDYILLSVVSYGEEILDDER------------------LVIHPPQAEIYTLSTNS 220

PmSFB1 147 STNINIKFS------------------------CVVLQFGFHPGVNDYKAVRMMRTNKN----------------------------ALAVEVYSLRTNS 194

PmSFB3 147 SANINIKFS------------------------HVALQFGFHPGVNDYKAVRMMRTNKK----------------------------ALAVEVYSLRTDS 194

PmSLF7 147 SANINVKFS------------------------HVALQFGFHPGLNDYKVVRMMRTNKN----------------------------ALAVEVYSLRTDS 194

PmSLFL1-Sf 150 SGLPDWWG--------------------------CAVGFGYDPKSKDYKVSRIASYQAEI--DG--------------------LIPPPRVEIYSLSTDS 201

PmSLFL2-S1 168 SCILLPPRVPRQFEENEDDDYYEEDDDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH-----------------------PSKVEVYSLAADT 244

PmSLFL2-S7 168 SCILLPPRVPRQFEENEDDDYYEEDDDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH-----------------------PSKVEVYSLAADT 244

PmSLFL2-Sf 168 SCILLPPRVPRQFEENEDDDYYEEDEDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH-----------------------PSKVEVYSLAADT 244

PmSLFL3-S7 155 SCLEDACS--------------------------CTLGFGYDPKRKDYVLLSIVSYGEEIFDDER------------------LVIHPPQAEIYTLSTNS 210

PmSLFL3-Sf 165 SCLEDACS--------------------------CTLGFGYDPKRKDYVLLSIVSYGEEIFDDER------------------LVIHPPQAEIYTLSTNS 220

PhSLFv 143 SPFGCP--------------------KGYHRSVEG-VGFGFDTISNYYKVVRISEVYCEEADGYPGPKD-------------------SKIDVCDLSTDS 202

PiSLF1 143 SPFGCP--------------------KGYHRSVEG-VGLGLDTISNYYKVVRISEVYCEEAGGYPGPKD-------------------SKIDVCDLGTDS 202

PiSLF2 143 SPFGCP--------------------KGYHRSVEG-VGFGLDTISNYYKVVRISEVYCEEADGYPGPKD-------------------SKIDVCDLSTDS 202

PiSLF3 143 SPFGSP--------------------KGYHRSVEG-VGFGLDTISNYYKVVRISEVYCEEDGGYPGPKD-------------------SKIDAFDLSTDS 202

PiSLF3A134 140 CPFGIP--------------------RGFRRSISG-IGFGFDSDANDYKVVRLSEVYKG-----TCDKK-------------------MKVDIYDFSVDS 194

PiSLFL1 145 SPFGCP--------------------KGYHRSIEG-IGFGFDSIVNDYKVVRLSDVYWDPPTDYPGPRE-------------------PKVDIYDLSIDS 204

PiSLFL2b 145 SPFVCP--------------------KGFHRSFRGGVGFGFDSIVKDYKLVAISEVFKDSEWG-TDEKE-------------------QKVEVYDMRIDS 204

PiSLFL2d 142 SPFGIQ--------------------RGFYRSVAG-VGFGYDSVHKTYKVVRISEVYGEPPFNCPSVME-------------------WKGEVYNSSTDS 201

Pa17 143 SPFGCP--------------------KGYHRSVEG-VGFGLDTISNYYKVVRISEVYCEEAGGYPGPKD-------------------SKIDVFDLRTDT 202

Pa19 143 SPFGCP--------------------KGYHRSVEG-VGFGFDTISYYYKVVRISEVYCEEADGYPGPKD-------------------SKIDVCDLSTDS 202

PaF1 143 SPFACP--------------------KGYHRSIEG-VGFGLDTISNYYKVVRISEVYCEEADGYPGPKD-------------------SKIDVCDLVTDS 202

NaDD1 144 SPFGCP--------------------NGYHRSVEA-LGFGFDSIANDYKIVRLSEVFWDPLYDYPGPRE-------------------SKVDIYDLSIDS 203

NaDD2 145 CPFGTP--------------------PGFRRSISG-IGFGFDSIANDYKFVRISEVYKD-----PCEKD-------------------MKVEVFDMCTDT 199

NaDD3 144 SPFGCP--------------------NGYHRSVEA-LGFGFDSIANNYKVVRISEIFWNPVYDYPGPRE-------------------SKVDVYDLSIDS 203

NaDD4 144 CPFGCP--------------------KGYHRTIEG-VGFGFISILNDFKVVRISDVFWDPPYGYPEGRD-------------------SKVDIYELSTDS 203

NaDD5 145 SPFGSP--------------------LGFYRSIRG-IAFGFDSVANGHKIVRLAEVRGEPPFYCFTMRE-------------------WRVEVYDLSTDS 204

NaDD6 146 SPFVCS--------------------KGYHRSFIGGVGFGFDSIGNDYKFVRISEVFLDTYWG-PEERE-------------------QKVEVYDLRSDS 205

NaDD7 143 SILPPPPYLS--------------SDKKLNYWMDMTMGIGFDPNTNDYKVVRILRPAHEYTFEDFDNHIR----------------DVSKVEVYNLSTNS 212

NaDD8 145 SPFGSP--------------------LGFHRSING-IAFGYDSIANEYKIVRIAEVRGEPPFCCFSVRE-------------------WRVEIYELSIDS 204

NaDD9 149 SPFGCP--------------------LGFHRSINC-VGFGFDLIVNDYKIVRISEVRGEPPFYCDSMRE-------------------WKVEVYELRTDS 208

NaDD10 140 SPFDCP--------------------LGFYRSIDG-VGFGFDSIAKDYKIVRISVIHGDPPFYDFNMRE-------------------QKVEVYELSTDS 199

AhSLF1E 144 TPFANP-----------------------EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN-------------------------IYVYYSDTNS 195

AhSLF2 144 TPFANP-----------------------EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN-------------------------IYVYYSDTNS 195

AhSLF2C 148 CPYVSP-----------------------KGFFDRIIGSGFGCTSMTDFKVVLIRSIWFDDVYDYS--------------------TYTLVHLYNSNTNS 204

AhSLF4 144 TPFANP-----------------------EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN-------------------------IYVYYSDTNS 195

AhSLF5 144 TPFANP-----------------------EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN-------------------------IYVYYSDTNS 195

AmSLFL 144 TPFANP-----------------------EGYCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN-------------------------IYVYYSDTNS 195

AT2G34280 133 STFQRLDRY----------------EHQVGSVSWAKLGFGKDKINGTYKPVWLYNSAELGGLNDDDEDYDDEDKNNISMICQGNNNTSTFCEVFDFTTKA 216

. . . ...*.. . ...... . . . ... ...


Supplementary figure 1 amino acid sequence alignment of the s locus f box genes

MdFBX1 223 WKEIKIDVTSDTDP-YCIPYSCSVYLKGFCYWFAMDNGE---------------YIFSFDLGDEIFHIIELPS-----------RREFGFKFY---GIFL 292

MdFBX2 223 WKEIKIDISIETRW-YCIPYSCSVYLKGFCYWFAYDNGE---------------YVFSFDLGDEIFHRIELPS-----------RRESDFKFY---GIFL 292

MdFBX3 222 WKEIKIDISSKTYP-----CSCSVYLKGFCYWFTRDGEE---------------FILSFDLGDERFNRIQLPS-----------RRESGLEFY---YIFL 287

MdFBX5 223 WKEIKIDTSSDTDP-YCIPYSCSMYLKGFCYWFANDNGE---------------YIFSFDLGDEIFHRIELPF-----------RRESDFKFC---GLFL 292

MdFBX6 221 WKEIKIEISSQTYH-----CSCSVYLKGFCYWFASDSEE---------------YILSFYLGDETFHIIQLPS-----------RRESGFTFD---YIFL 286

MdFBX7 221 WKEIKINISSTTHP-----YPFSVYLKGFCYWFATDGEE---------------CILSFDLGDEIFHRIQLPS-----------KIESGFEFC---GLFL 286

MdFBX8 227 WKEIKINISSKILSLYSYPYSCSVYLKGFCYWLSSDDEE---------------YICSFNLGDEIFDRIELPS-----------RRESGFKLD---GIFL 297

MdFBX9 227 WRVIKIDISSETYH-----YSSSVYLNGFFYWFAIDGEK---------------YILSFDLGDEIFHRIQLPS-----------RRESDFEFS---NIFL 292

MdFBX10 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

MdFBX11 222 WREIKIDISTKTYS-----CSCQVYLKGFCYWYATDAEE---------------YILSFDLGDEIFHRIQLPS-----------RRESGFKFY---YIFL 287

MdFBX12 223 WKEIKIEISSKTYQ-----CYGSEYLKGFCYWLANDGEE---------------YILSFDLGDEIFHIMQLPS-----------RRESGFKFY---NIFL 288

MdFBX13 218 WKEIKIDISSTTYS-----WSCSVYLKGFCYWYATDDEE---------------YVLSFDLCDETFHRIQFPS-----------RGESGFTFF---YIFL 283

MdFBX14 238 WRVIKIEISSDTYN-----CSCSVYLKGFCYWFASDDEE---------------YILSFDLGDEIFHRIQLPR-----------RKESGFLFY---DLFL 303

MdFBX15 223 WKEIKIDTSSDTDP-YCIPYSRSMYLKGFCYWFANDNGE---------------YIFSFDLGDEMFHRIELPF-----------RRESDFKFC---GLFL 292

MdFBX16 227 WRVIKIDISSETYH-----YSSSVYLNGYFYWFAIDGEK---------------YILSFDLGDEIFHRIQLPS-----------RIESDFEFS---NIFL 292

MdFBX17 221 WKEIKIDISSSTHP-----YPFSVYLKGFCYWFATDGEE---------------CILSFDLGDEIFHRIQLPS-----------KIESGFNFC---GLFL 286

MdFBX18 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDLEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

MdFBX19 222 WKEIKIDISSTTYS-----CSRSVFMKGFCYWYATDGEE---------------YILSFDLSDDKFHIIQLPS-----------RRESGFRFY---YIFM 287

MdFBX20 230 WKEIKIEISSKTYQ-----CYGSEYLKGFCYWLANDGEE---------------YILSFDLGDEIFHKIQLPS-----------RRESGFKFC---NIFL 295

MdSFBB3-alpha 222 WKEIKIDISSTTYS-----CSRSVFMKGFCYWYATDGEE---------------YILSFDLGDDTFHIIQLPS-----------RRESGFRFY---YIFL 287

MdSFBB3-beta 221 WKEIKIDISIKTYH-----CSCSVYLKGFCYWFASDNEE---------------YILAFYLGDETFHIIQLPS-----------RRESGFTFD---YIFL 286

MdSFBB9-alpha 223 WKEIKIDVSSDTDP-YCIPYSCSVYLKGFCYWFACDNGE---------------YIFSFDLGDEIFHIIELPS-----------RREFGFKFY---GIFL 292

MdSFBB9-beta 223 WKEIKIDISIETRW-YCIPYSGSVYLNGFCYWFAYDNGE---------------YVFSFDLGDEIFHKIDLPS-----------RRESDFKFY---GIFL 292

PpSFBB1-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB2-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB3-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB4-alpha 223 WKEIKIDTSSDTDP-YCIPYSCSVYLKGFCYWFANDNGE---------------YIFSFDLGDEIFRRIELPF-----------RRESDFNFY---GLFL 292

PpSFBB4-beta 222 WRVIEIEISSDTYN-----CSCSVYLKGFCYWFASDDEK---------------YVLSFDLGDEIFHRIQLPY-----------RKESGFLFY---DLFL 287

PpSFBB4-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB5-alpha 223 WKEIKIDTSSDTDP-YCIPYSCSVYLKGFCYWFANDNGE---------------YIFSFDLGDEIFRRIELPF-----------RRESDFNFY---GLFL 292

PpSFBB5-beta 222 WRVIEIEISSDTYN-----CSCSVYLKEFCYWFASDDEE---------------CILSFDLGHEIFHRIQLPC-----------RKESGFLFC---DIFL 287

PpSFBB5-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB6-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB7-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB8-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBB9-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PpSFBBk-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE---------------YIFSFDLANEISDMIELPF-----------RGEFGFKRD---GIFL 294

PdSFB1 195 WTMIEAIPPWLKCT---WQHHQGTFFNGVAYHIIEKGPTFS--------------VISFDPGSEEFEEFIAPD---------------AICSLWRLCIHV 262

PdSFBa 194 WKRIEVIPPWLKCD---WQHYKGIFLNGVVYHLIEKGPTFS--------------LMSFDSGNAEFEEFITPG---------------AICRSRGLFIAV 261

PdSFBd 195 WTMIEAIPPWLKCT---WQHHQGTFFNGVAYHIIEKGPTFS--------------VISFDSGSEEFEEFIAPD---------------AICSLWRLCIHV 262

PdSFBf 195 WKMVEAIPPWLKCT---WQHHKGIFFNGVAYHIIEKGPIFS--------------VISFDSGSEEFEEFIAPD---------------TICTSWDLCIDV 262

PcSFB9 195 WKMIKAIPPWLKCT---WQPFKGTFFNGVAYHIILKGPIFS--------------IMSFDSDSEEFEEFIAPD---------------AICHSWELCIDV 262

PsSFBc 195 WKMIEAIPPWLKCT---WQHQMGTFSNGVAYHIIQKGPIFS--------------VISFDSDSEEFQEFIAPD---------------AICSSWGLCINV 262

ParSFBc 195 WKMIEAIPPWLKCT---LEHHRGTFFSGVAYHIIQKGPMLS--------------IMSFDSGSEKFEEIIAPD---------------AICSLWGLYIDV 262

PavSFB2 195 WKMIEAIPPWLKCT---WQHHKGTFFNGVAYHIIQKGPLFS--------------IMSFDSGSEVFEEFIAPD---------------AICNLWGLCIQV 262

PavSFB5 195 WKMIEAIPPWLKCT---WQHHRGTFFNGVAYHIIQKGPIFS--------------IMSFDSGSEEFEEFIAPD---------------AVCSSWGLCIDV 262

PavSFB6 195 WKMIEAIPPWLKCT---WQHHKGTFFNGVAYHIIEKGPICS--------------IMSFDSGSDEFEEFIAPD---------------AICSPSELCIDI 262

PavSFB9 195 WKMIKAIPPWLKCT---WQPFKGTFFNGVAYHIILKGPIFS--------------IMSFDSDSEEFEEFIAPD---------------AICHSWELCIDV 262

PavSLFL1-S1 200 WREIKNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHHILLPDSFYMYEEGSAYAYEMSYIMYTDLRIIL 295

PavSLFL1-S2 204 WREIKNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVILFDTGDEIFHRILFPDSFYMYEEGSSYAYEMSYIMYTDLRIIL 299

PavSLFL1-S4 202 WREIKNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHHILFPDSFYMYEEGSSYAYEMSYIMYTDLRIIL 297

PavSLFL1-S6 202 WREIRNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHNLLFPDSFYMYEEGSSYAYEMSYLMYCDLRIIL 297

PavSLFL2-S4 241 WREIPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE-------------RNVILSFDMSEEVFHGIALPE-----------SGPDAYEYT---SIAV 309

PavSLFL3-S4 221 WRGIETHYLETETTYFWGNETFSTYFNGVFYWLGYEEKKDFVSFYDRLEEEKTQVIILFDTFDEVFHNMPLPDCFYEFP-----THEMS--------LTV 307

PmSFB1 195 WKMIEAIPPWLKCT---WQHHKGIFFNGVAYHIIEKGPIFS--------------IMSFDSGSEEFEEFIAPD---------------AICSSLGLCIHV 262

PmSFB3 195 WKMIEAIPPWLKCT---WQHHKGTFFNGVAYHIIEKGPIFS--------------IMSFDSGSEEFEEFIAPD---------------AICNSWGLCIDV 262

PmSLF7 195 WKMIETIPPWLKCT---WQHHKGTFFNGVAYHIIEKGPLFS--------------IMSFDSGSEEFEEFLAPD---------------AICNSWGLCIDV 262

PmSLFL1-Sf 202 WREIKNNSLETDTTCFFP-DYFQMYFQGFCYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHHILLPDNFYMYEEGSSYAYEMSYIMYTDLRIIL 297

PmSLFL2-S1 245 WREVPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE-------------RNVILSFDMSEEVFHDIALPE-----------SGPDAYEYT---SIAV 313

PmSLFL2-S7 245 WREVPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE-------------RNVILSFDMSEEVFHDIALPE-----------SGPDAYEYT---SIAV 313

PmSLFL2-Sf 245 WREVPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE-------------RNVILSFDMSEEVFHDIALPE-----------SGPDAYEYT---SIAV 313

PmSLFL3-S7 211 WREIETHYLETETTYFWGNETFSAYFNGVFYWLGYEEKKEFVSFYDRLEEEKKQVIILFDTFDEVFHNMPLPDCFYEFP-----SHEMS--------LTV 297

PmSLFL3-Sf 221 WREIETHYLETETTYFWGNETFSAYFNGVFYWLGYEEKKEFVSFYDRLEEEKKQVIILFDTFDEVFHNMPLPDCFYEFP-----SHEMS--------LTV 307

PhSLFv 203 WREL--DHV--QLPSIYWVPCAGMLYKEMVHWFATTD-TS-------------MVILCFDMSTEMFHDMKMPD------------TCSRITHELYYGLVV 272

PiSLF1 203 WREL--DHV--QLPLIYWVPCSGMLYKEMVHWFATTD-ES-------------MVILCFDMSTEMFRNMEMPD------------SCSPITHELYYGLVI 272

PiSLF2 203 WREL--DHV--QLPSIYWVPCAGMLYKEMVHWFATTD-MS-------------MVILCFDMSTEMFHDMKMPD------------TCSRITHELYYGLVI 272

PiSLF3 203 WREL--DHV--QLPLIYWLPCSGMLYKEMVHWFATTD-MS-------------TVILCFDMSTEMFRNMKMPD------------TCS-VTHKQYYGLVI 271

PiSLF3A134 195 WREL--LGQ--DVPFVFWFPCAEILYKRNFHWFAFAD-D--------------VVILCFDMNTEKFHNMGMPD------------ACHFDDGKS-YGLVI 262

PiSLFL1 205 WREL--SEV--EFPSIYYLPCSEMYYKEAVHWFSHID-MD-------------VMILCFDIITEIFRTMKIPG------------DCTFLEIPR-YGLAI 273

PiSLFL2b 205 WRDL--NHVDQQLPTVYYYPCFERLYNGAFHWYAINDRFD-------------HVILSFDISTEIFHSIKMPA------------TDKSSGGKK-YALIV 276

PiSLFL2d 202 WREL--DCVDQELPWPYNFAYSEIFYEGAFHWYAHKN-V--------------VLILCFDVNTETFRTMEVPE------------PCASYDEKC-HSLLV 271

Pa17 203 WKEL--DHV--QLPLIYWLPCSGMLYKQMVHWFATTD-M--------------MVILCFDISTEMFRNMKMPD------------TCCLITHELYYGLVI 271

Pa19 203 WREL--DHV--QLPSIYWVPCAGMLYKEMVHWFATTD-TS-------------MVILCFDMSTEMFHDMKMPD------------TCSRITHELYYGLVI 272

PaF1 203 WREL--DHI--QLPLIYWVPCSGMLYMEMVHWFATTD-IS-------------MVILCFDMSTEVFRNMKMPD------------TCTRITHELYYGLVI 272

NaDD1 204 WREL--DSE--QLPLIYWVPCAETFYKEAFHWFGTID-LS-------------MVILCFDVSTEIFRNMKMPR------------TFI-FDNAQYPGLVI 272

NaDD2 200 WREL--HGQ--QLPMAFWTPCSEIIYNCAFHWFATAD-D--------------VVILCFDMCAEKFYNMETPG------------TCHWFDGKC-YGLVI 267

NaDD3 204 WREL--DHV--QVPLIYWLPCSETLYNEVVHWFASTD-LS-------------LVILCFDMCTEIFRNIKMPD------------TFI-FDNAEFYGLVI 272

NaDD4 204 WREL--EPV--QVPRVYWLPCSEMVYQEAVHWFATIE-E--------------VVILCFDIVTETFRNMKMPD------------ACYSIKQSR-YGLIV 271

NaDD5 205 WREV--DNVDQHLPYVHWYPCAELFFKGASHWFGSTN-T--------------AVILCFDMSTETFRNIKMPD------------TCHSKDRKC-YALVV 274

NaDD6 206 WRDL--NHVDQQLPTIFWNQCFEMLHNGAFHWYAVGD-LT-------------YEILCFDFSTEIFRSMKMPE------------SCNAYDGKR-YSLAV 276

NaDD7 213 WRRIK-DLECL----VDTLHCSHVFFNGAFHWRR--YTKSD-----------DYFIVSFNFSIESFQMIPSPE------------GLTDEGR---KSLFV 279

NaDD8 205 WREV--DNVDQQLPYVHWNPCAELFYKGASHWFGNTN-T--------------VVILCFDMSTETFRNIKMPD------------TCHSKYRKR-YGLLV 274

NaDD9 209 WREL--DQVNLQLPYVHWNPCSDMFYSGASHWFGNAN-T--------------VVILCFDLSTETFRNMKMPN------------TCHSRDEKC-YGLVV 278

NaDD10 200 WREL--DLLDQHLPNVDYYPCSEKFYNGASHWLGNDT-T--------------LVILCFDMSTEIFRNIKMPS------------ACHSNDGKS-YGLTV 269

AhSLF1E 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY-----------ADFILTFDIITEVFKEMAYPH------------CLAQFSNSF-LSLMS 269

AhSLF2 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY-----------ADFILTFDIITEVFKEMAYPH------------CLAQFSNSF-LSLMS 269

AhSLF2C 205 WRITN-DVGTLSFKDLWDYPCSQRFFHGNLHWNAASYDYSS-----------RKAILTFNLNTETFGQLEYPD------------YFKKLHETG-ICFTI 279

AhSLF4 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY-----------ADFILTFDIITEVFKEMAYPH------------CLAQFSNSF-LSLMS 269

AhSLF5 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY-----------ADFILTFDIITEVFKEMAYPH------------CLAQFSNSF-LSLMS 269

AmSLFL 196 WRHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY-----------ADFILTFDIITEVFKEMAYPH------------CLAQFSNSF-LSLMS 269

AT2G34280 217 WRFVVPASPYRILP-----YQDPVYVDGSLHWLTEGETTN---------------VLSFDLHAETFQVVSKAP--------------FLHHHDYSSRELI 282

*... . . .. .. . ...*. . . . . .


Supplementary figure 1 amino acid sequence alignment of the s locus f box genes

MdFBX1 293 YNESITSYCSRYE--EDC---KLFEIWVMDD---DDGVKSSWTKLLTVGPFKDI---DYPLTLGKCDEVLMLGS-YGRAAFCNSS----IGNLKYLHIPP 376

MdFBX2 293 YNESVTSYCYRHE--EDC---ELFEIWVMDD---YDGVKSSWTKQLTIGPLKDI---DYPLTLWKCDEILMLGS-YGRAASCNSS----TGNLKYLHIPP 376

MdFBX3 288 CNESIASFCSRYDRSEDS---KSCEIWVMDD---YDGVKSSWTKLLVAGPFKGI---EKPLTLWKCDELFMIDT-DGRVISYNSS----IGYLSYLHIPP 373

MdFBX5 293 YNESVASYCSCYE--EDC---KLVETWVMDD---YDGVKSSWTKLLTVGPFKDI---ESPLKFWKCDEVLILSS-YGKATSYNSS----TGNLKYFHIPP 376

MdFBX6 287 LNESLASFCSPYNPSEDS---KLFEIWVMDD---YDGVKSSWTKLLTVGPFKGI---EYPLTLWKCDELLMLAS-DGRATSYNSS----TGNLKYLHIPP 372

MdFBX7 287 YNESITSYCCHNDPSEDS---KLFEIWVMDG---YGGVNSSWTKILTIGPSKDI---EYPLTFWKCDELLMFAS-GRRVTSYNSS----TGNLKDLHIPP 372

MdFBX8 298 YNESITYYCTSYE--ERS---RLFEIWVMDN---YDGVKSSWTKHLTAGPFKGI---EFPLTLRKHDELLMIAS-DGRATSYNSN----TGNLKYLHIPV 381

MdFBX9 293 CNKSIASFCSCCDPSDED--STLCEIWVMDD---YDAVKRSWTKLLTFGPLKDI---ENPFTFWKTDELLMVAA-GGRATTYNSS----TGNLNYLHIPP 379

MdFBX10 295 YNESLTYYCTSYE--EPS---TLFEIWVMGY---DDGFKSSWTKHLTAGPFKDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

MdFBX11 288 RNESLASFCSRYDRSDKS---ESCEIWVMHN---YDGVKSSWTKLLIIGPLQAI---GKPLTFWKSDELLMLAS-DERATSYNSS----TGNLKYLHIPP 373

MdFBX12 289 CNESIASFCCCYDPTNED--STLCEIWVMDD---YEGVKSSWTKLLTVGPLKGI--NENPLAFWKSDELLMVSC-DGRVTSYNCS----TKNLSYLHIPP 376

MdFBX13 284 RNESLTSFCSRYDRSGDS---QSCEIWVMDD---YDGVKSSWTKLLTVGPLQAI---EKPLTFWKSDELLMLAS-DGRTTSYNSS----TRNMKYIHIPP 369

MdFBX14 304 FNESIASFCSHYDKSDNSRILEILEIWVMDD---CDGVKSSWTKLQTLGPFKDN---ENLLTFWKSDELLMVTS-DNRVISYNSS----TGNLKYIHIPP 392

MdFBX15 293 YNESVASYCSCYE--EDC---KLVEIWVMDD---YDGVKSSWTKLLTVGPFKDI---ESPLKFWKCDEVLILSS-YGKATSYNSS----TGNLKYFHIPP 376

MdFBX16 293 YNKSIASFCSCCDPSDAD--STLCEIWVMDD---YDGVKRSWTKLLTFGPLKDI---ENPFTFWKTDELLMVAA-GGRATTYNSS----TGNLNYLHIPP 379

MdFBX17 287 YNESITSYCCRYDPSEDS---KLFEIWVMDG---YGGVKNSWTKLLTVGPFKGI---EYPLTFWKCNELLMVAS-SRRVTSYNSS----TGNLKDLHIPP 372

MdFBX18 295 YNESLTYYCTSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTVGPFKDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

MdFBX19 288 RNESLASFCSRYDRSEDS---ESCEIWVMDD---YDGIKRSWTKLLTIGPLQGI---KKPLTFWKSDELLMLDS-DGRATSYNSS----TGNLNYIHIPP 373

MdFBX20 296 CNESIASFCCCYDPKNED--STLCEIWVMDD---YGGVKSSWTKLVTVGPLKGI--NENPLAFWKSDELLMVSC-DGSVTSYNSS----TKNLSYLNIPP 383

MdSFBB3-alpha 288 RNESLASFCSRYDRSEDS---ESCEIWVMDD---YDGDKSSWTKLLNIGPLQGI---KKPLTFWRSDELLMLDS-DGRATSYNYS----TRNLKYLHIPP 373

MdSFBB3-beta 287 RNESLASFCSPYNPSEDS---KLFEIWVMDD---YDGVSSSWTKLLTVGPFKGV---EYPLTLWKCDELLMLAS-DGRATSYNSS----TGNLKYLHIPP 372

MdSFBB9-alpha 293 YNESITSYCSRYE--EDC---KLFEIWVMDD---YDGVKSSWTKLLAVGPFKDI---DYPLTLGKFDEVLMLGS-YGRAAFCNSS----TGNLKYLHIPP 376

MdSFBB9-beta 293 YNESVTSYCYRHE--EDC---ELFEIWVMDD---YDGVKSSWTKLLTIGPLKDI---DYPLTLWKCDEVLMLGS-YGRAASCNSS----TGNLRYLHIPP 376

PpSFBB1-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB2-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB3-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKCDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB4-alpha 293 YNESVASYCSRYE--EDC---KLLEIWVMDD---HDGVKSSWTKLLTVGPFKDI---ESPSTFWKCDEVLILSS-YGKATSYNSG----TENLKYLHIPP 376

PpSFBB4-beta 288 YNESIASFCSHYD-NDNAGILEILEIWVMDD---CDGVKSSWTKLLTLGPFEDN---ENLLTFWKSDELLMVTS-DKRAISFNSS----TGNLKYIHIPP 375

PpSFBB4-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFIDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB5-alpha 293 YNESVASYCSRYE--EDC---KLLEIWVMDD---YDGVKRSWTKLLTVGPFKDI---ESPSTFWKCDEVLILSS-YGKATSYNSS----TGNLKYLHIPP 376

PpSFBB5-beta 288 YNESIASFCSHYDESDNSGILKILEIWVMDD---CDGVKSSWTKLLTLGPFKGN---ENLLTFWKSDELLIVTS-DQRAISYNSS----TGNRKYIHIPP 376

PpSFBB5-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB6-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB7-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB8-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBB9-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWRHDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378

PpSFBBk-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSY----TGNFKYLHIPV 378

PdSFB1 263 YKEQICLLFGYYSCEEEG--MENIDLWVLQEK--RWKQLCPFIYDPLDDFYQIIGISTDNKLIMARKDFS-KGGVELQLGNYESK---QVLETGIKLAIV 354

PdSFBa 262 YKEQICLLFDFYCCEEEG--MEKIDFWVLEEK--QWTQLAPFVY--PSDSYKIIGISIDNELLLRKHDFSSVGLADLYLCNYESK---QVRQAGIKLAVM 352

PdSFBd 263 YKEQICLLFGYYSCEEEG--MENIDLWVLQEK--RWKQLCPFIYDPLDDFYQIIGISTDNKLIMARKDFS-KGGVELQLGNYESK---QVLETGIKLAIM 354

PdSFBf 263 YKEQICCLLKFYSCEEED--MDKIDLWVLQEK--RWKQLCPFVY-PFNYYYGTIGISIDNKLLMLKRDDI-RGQPDLHLCDYDSKPTQQVLETGIKLATM 356

PcSFB9 263 YKEQICLLFSCYSCEEED--MEKVDLWVLQEK--RWKLLCPFIY-PLGYDYRPIGISIDNKLSMQRKDYT-WGIADLHLCDYESK---QVQETGIKLAIM 353

PsSFBc 263 YKEQICLLFRFYGCEEEG--MEQVDFWVLQEK--RWNQLCPFIYP--RSCYRIMGISINNELILQKRDLN-KGVAYLYLCNYKSK---QVLETGITLAIV 352

ParSFBc 263 YKEQICLLFICYGCEEEG--MEKADLWVLQEK--RWKQLSPFI--------------------------------------------------------- 301

PavSFB2 263 YKEQICLLSGFYGCEEEG--MEKIDFWVLQEN--RWKQLCPFIYDPLDYCHRIIGISIDNELLMEREDFL-RGVGYLHLCNYESK---QVLETGIELAVM 354

PavSFB5 263 YNDQICLLSGFYGCEDEG--LDKIDLWVLQEK--QWKELCPVIFPPLGDCDRIIGISIGIELLMEKKDFD-KGVGELYLCNYESK---QVLQTGIKLAVM 354

PavSFB6 263 YKERVCLLFSFYSCDEEG--MVPNDLWVLQEK--RWKQLCPFIY-PAG-SYGTIGITIDNKLLMVRRDFL-RGAGDLCLCNYESK---QVFETGIELAVM 352

PavSFB9 263 YKEQICLLFSCYSCEEED--MEKVDLWVLQEK--RRKLLCPFIY-PLGYDYRPIGISIDNKLSMQRKDYT-WGIADLHLCDYESK---QVQETGIKLAIM 353

PavSLFL1-S1 296 WNGSIALFGINRFSALPE----SYGVWVLDD---FDGANGSWTKHLTFDPLEG--I-KRVLEILKSDEILMVTE-DGDIVSYNVA----IEKLKNLPMN- 379

PavSLFL1-S2 300 WNGSIALFGFNRFSAFPD----SYGIWVLAD---FDGAKGSWTKHLTFEPLVA--I-KRVLEFWKSDEILMVTE-DGDIVSYNLA----TEKLKNIPIN- 383

PavSLFL1-S4 298 WNGSIALFGFNRFSVFPD----SYGVWVLDD---FDGAKGSWIKHLTFEPLMG--I-KRVLEFWKSDEILMVTEEDGDIVSYSLE----TEKLKNLPMN- 382

PavSLFL1-S6 298 CNGSIALFGFNRFSVFPD----SYGVWVLDD---FDGAKGSWTKHLTFEPLMG--M-KRVLEFWRSDEILMVTE-DGDIVSYNLA----TEKLKNLPMN- 381

PavSLFL2-S4 310 WKDSLVLLTYPVENEAPK----TIDLWVLDEDL-KGA-KGLWTKHLAIGPLEKG--VEAPLVFWKDEELLMVTT-NGDVVNYSLD----TLKLKHVPRHG 396

PavSLFL3-S4 308 WNESIALFGFYRCEFET------FEVWVMDE---FDG----WTKHLSVVPKVDQEV-DIPLALWR-NEVLLVDR-DGRIFSYNLD----TENLKYLPVHG 387

PmSFB1 263 YKEQICLLSGFYGSEEED--MDKIDLWVLQEK--RWKQLCPFIF-PLDHCHRTIGFSADNELLMERRDFI-KGITHLCLCNYESK---QVLETGIRLAVM 353

PmSFB3 263 YKEYICLLFSFYSPQEDG--MGKKDLWVLQEK--RWKQLSPFMY-PFDCCS-TIGIRIDNELLMEIRDFS-RGVGHLHLCNYESK---QVLETGIELAVV 352

PmSLF7 263 YKEQICLLFTFYDCEEED--MEKSDFWVLQEK--RWKQLSPFIY-PSN-CYSTMGISIDNELLMQRRDHI-KGGADLYLCNYESK---QVLETGLRLGTV 352

PmSLFL1-Sf 298 WNGSIALFGFNRFSVFPD----SYGVWVLDD---FDGAKGSWTKHLTFEPLMG--I-KRVLEFWKSDEILMVTEEDGSIVSYNLE----TETLKNVPMN- 382

PmSLFL2-S1 314 WKDSLVLLTYPVENEAPK----TLDLWVFDEDL-KGA-KGLWTKHLAIGPLEKG--VEAPLVFWKDEELLMVTT-NGDVVNYSLD----TQKLKHVPRHG 400

PmSLFL2-S7 314 WKDSLALLTYPVENEAPK----TLDLWVLDEDL-KGA-KGLWTKHLAIGPLEKG--VEAPLVFWKDKELLMVTT-NGDVVNYSLD----TQKLKHVPRHG 400

PmSLFL2-Sf 314 WKDSLVLLTYPVENEAPK----TLDLWVLDEDL-KGATKGLWKKHLAIGPLEKG--VEAPLVFWKDEELLMVTT-NGDVVNYSLD----TQKLKHVPRHG 401

PmSLFL3-S7 298 WNESIALFGFYRCEFEP------FEVWVMDE---FDG----WTKHLSVVPKVDQEV-DIPLALWRRNEVLLVDR-DGRIFSYNFD----TENLKYLPVHG 378

PmSLFL3-Sf 308 WNESIALFGFYRCEFEP------FEVWVMDE---FDG----WTKHLSVVPKVDQEV-DIPLAIWRRNEVLLVDR-DGRIFSYNFD----TENLKYLPVHG 388

PhSLFv 273 LCESFTLIGYSNPISSIDPVEDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKNHILLLQSRSGL-LISYDLN----SGEAKELNLHG 359

PiSLF1 273 LCESFTLIGYSNPISSIDPVKDKMHIWVMMEY----GVSESWIMKYTIK-PLSI---ESPLAVWKKNILLLQSRSGR-LISYDLN----SGEAKELNLHG 359

PiSLF2 273 LCESFTLIGYSNPISSTDPAHDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKNHILLLQCRSGL-LISYDLN----SGEAKELNLHG 359

PiSLF3 272 LCESFTLIGYPNPVSPIDPAHDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKKNILLLQSRSGL-LISYDLN----SGQAKELNLHG 358

PiSLF3A134 263 LFKCMTLICYPDPMP-SSPTEKLTDIWIMKEY----GEKESWIKRCSIR-LLP----ESPLAVWKDEILLLHSKMGH-LIAYDLN----SNEVQELDLHG 347

PiSLFL1 274 LNECLTLISYPDPMCSDEPIEELIYIWIMKEY----GESESWIKKYTIK-PLPI---ESPLAIWKDHLLLLQSISGIILFSWDLN----SNEVKEFELHG 361

PiSLFL2b 277 LNESLTLICYPNPDCEMDPSKDSMDIWIMEEY----GVYESWTKKYIIK-PLPI---ESPLAIWRDYLLLLQSKSGL-LVSYDLS----SNEVKEFDLHG 363

PiSLFL2d 272 LDEFLTLFCYPDPRRESSPIQETIEIWTMQEY----RVNESWIKKHTIK-SPPI---ESPLAIWKDRLLLFQDKSGI-LISYDLN----SDEVKEFKLDG 358

Pa17 272 LCESFTLIGYSNPISSIDPARDKMHIWVMMEY----GVSESWIMKYTIR-PISI---KSPLAIWKNNILLLQNRSGI-LISYDLN----SGEAKEFNLHG 358

Pa19 273 LCESFTLIGYSNPISSIDPVEDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKNHILLLQSRSGL-LISYDLN----SGEAKDLNLHG 359

PaF1 273 LCDSFTLIGYSNPIGSIDSARDKMHIWVMMEY----GVSESWIMKYTIK-PLSI---ESPLAVWKNNILLLQSRSGL-LISYDLN----SGEAKELNLHG 359

NaDD1 273 LSESLTLICYPNPIS-IDHIQEVTRIWVMKEY----GVSESWILKDTIR-LPPI---EYPLDIWKNNLLLFQSKSGL-LISYNLK----SDEVKELKLNG 358

NaDD2 268 LYKSLTLICYPDPMS-TDPTEDLMDIWIMKEY----GKKESWIKKCSIG-PLPI---ESPLAVWKDDLLLFQTKSGY-LIAYDLN----SDEVKEFNSHG 353

NaDD3 273 LSESLTLICYPNPIS-INPIQELTHIWVMKEY----GVSESWFLKDTIR-PPPI---ERPLDVWKNNIILFESKSGL-LVSYKLN----SNEVEELKLHG 358

NaDD4 272 LNESLALICYPDPRCAVDPTQDFIHIWLMEEY----GVSETWIKKYTIQ-SLPI---ESPLAVWKDHLLLLQSKIGQ-LISYDVN----SDEMKEFDLHG 358

NaDD5 275 MNDSLTLICYPYPGCEIDPAIDFMEIWEMKEY----GVNETWSKKYTIT-PLAI---NSPLAIWKEHILSLQSISGH-LISYDLN----SDEVKELDLHG 361

NaDD6 277 VNESLTLICYPSPDSEIDQTQNTMDIWIMMEY----GVNESWTKKYIIS-PLPI---ESPLTIWRDHLLLLQSKTGQ-LISYNLR----SNEVKEFDLRG 363

NaDD7 280 LSESLALICFTENYPREMLVHQSIDIWVMKKY----GVRESWIKEFTVG-PMLI---KIPLSVWKNDTELMIESNNGKLMSCNLL----SQATKDLDMSG 367

NaDD8 275 MNDSLTLISYPYPGCEIDSAIDFMEVWVLKEY----GVNESWSKNYTIT-PLAI---ESPLAIWKDRLLLLQSISGH-LISYDLN----SGEVKELNLYG 361

NaDD9 279 LNEYLTLICYPYPGKVIDPLKDFMDIWMMKDY----GVNESWIKKYTIT-PLSI---ESPLAVWKDHLLLLQSRKGF-LVSYDLK----SKEVKEFNFHG 365

NaDD10 270 LNECLTLICYTYSSAVNDQAENLIDVWIMKEY----DVNESWIKKYTIIRTLSI---KSPLAVWKDHLLLIQTKNGL-LISYDLN----SDEVKQYNLHG 357

AhSLF1E 270 LNECLAMVRYKE----WMEEPELFDIWVMKQY----GVRESWTKQYVIG-PQVV---VCSHVCWKSDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353

AhSLF2 270 LNECLAMVRYKE----WMEDPELFDIWVMNQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNKIEKLPIYA 353

AhSLF2C 280 INNCFAIILYKD----SKEEPQPLDIWVMKKY----GFGESWTKQFTVG-PYQV---VSCILPWKNDEWLFVESSDGQLATCALH----TNEFRRLPIYG 363

AhSLF4 270 LNECLAMVRYKE----WMEEPELFDIWVMNQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353

AhSLF5 270 LNECLAMVRYKE----WMEEPELFDIWVMNQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353

AmSLFL 270 LNECLAMVRYKE----WMEEPELFDIWVMKQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353

AT2G34280 283 MCNLDDRLCVSEKMWPNQ------VIWSLDSDHKTWKEIYSIDLNITSSLFGSNGFALRPLGVFDKDKLLFCEPEYGDQLLTHDP------KTKSYEFDY 370

... . . . . .*... .. .... .. .. . . .. .. .... . .... . . .


Supplementary figure 1 amino acid sequence alignment of the s locus f box genes

MdFBX1 377 IIN-----WMIDYVKSIVPVK----------------- 392

MdFBX2 377 IIN-----WMIDYVKSIVPVK----------------- 392

MdFBX3 374 IINRVIDSQALIYVESIVPIK----------------- 394

MdFBX5 377 IIN-----WMIDYVETIVPVK----------------- 392

MdFBX6 373 ILNKVVDFEGLIYVKSIVPLN----------------- 393

MdFBX7 373 IMHQVTDLEALIYEESLVPIK----------------- 393

MdFBX8 382 IIYRN---RVIDYAKSIVPVKRVEGKVPFSPI------ 410

MdFBX9 380 ILNEVRDFEALIYMESIVPVK----------------- 400

MdFBX10 379 IINEN---RVVDYVKSIILVN----------------- 396

MdFBX11 374 ILNRVVDFQALIYVKSIVSFK----------------- 394

MdFBX12 377 IVNEVRDFQAVIYVESIVPVK----------------- 397

MdFBX13 370 ILNTVVDFQALTYVESIVPLK----------------- 390

MdFBX14 393 IINKITGFEALIYVESIVSVKRVEGKVPFSPI------ 424

MdFBX15 377 IIN-----WMIDYVETIVSVK----------------- 392

MdFBX16 380 ILNEVRDFEALIYVESIVPVK----------------- 400

MdFBX17 373 IIHQVTDLQAFIYEESLIPIK----------------- 393

MdFBX18 379 IINEN---RVVDYVKSIVLVN----------------- 396

MdFBX19 374 ILNRVVDFEVLIYVKSIVHVK----------------- 394

MdFBX20 384 ILNEVRDFQAVIYVESIVSVK----------------- 404

MdSFBB3-alpha 374 ILNRVVDFEVLIYVKSIVHVK----------------- 394

MdSFBB3-beta 373 ILNKVVDFEGLIYVKSIVPLK----------------- 393

MdSFBB9-alpha 377 IIN-----WMIDYVKSIVPVK----------------- 392

MdSFBB9-beta 377 IIK-----WMMDYVKSIVPVQ----------------- 392

PpSFBB1-gamma 379 IINQN---RVVDYVKSIILVN----------------- 396

PpSFBB2-gamma 379 VINQN---RIVDYVKSIILVN----------------- 396

PpSFBB3-gamma 379 IINQN---RVVDYVKSIILVN----------------- 396

PpSFBB4-alpha 377 IIN-----WMIDYVETIVPVK----------------- 392

PpSFBB4-beta 376 IMNKVTDFEALIYVESFVSVK----------------- 396

PpSFBB4-gamma 379 IINQN---RVVDYVKSIILVN----------------- 396

PpSFBB5-alpha 377 IIN-----WMIDYVETIVPVK----------------- 392

PpSFBB5-beta 377 IINKITDLEALIYVESIVSIK----------------- 397

PpSFBB5-gamma 379 VINQN---RIVDYVKSIILVN----------------- 396

PpSFBB6-gamma 379 VINQN---RIVDYVKSIILVN----------------- 396

PpSFBB7-gamma 379 IINQN---RVVDYVKSIILVN----------------- 396

PpSFBB8-gamma 379 IINQN---RVVDYVKSIILVN----------------- 396

PpSFBB9-gamma 379 IINQN---RVVDYVKSIILVN----------------- 396

PpSFBBk-gamma 379 VINQN---RIVDYVKSIILVN----------------- 396

PdSFB1 355 RYGESEFLFAMTYVESLLLLN----------------- 375

PdSFBa 353 EYGHHELFFATTYIESLLFLNKSLKRDV---------- 380

PdSFBd 355 RYGESEFLFAMTYVESLALLNN---------------- 376

PdSFBf 357 KYGEIEFLFSLSYIESLVLLNTY--------------- 379

PcSFB9 354 KYDEIEFLFSITYIKSLVLLNND--------------- 376

PsSFBc 353 TYDDIEFLFSITYIQSLVLLNNY--------------- 375

ParSFBc 302 -------------------------------------- 301

PavSFB2 355 KYGEIEFSYAITYIESLVLLDKY--------------- 377

PavSFB5 355 KYDEIEFVFAITYTESLVLLNNY--------------- 377

PavSFB6 353 KYGEIELLFAITYIESLALLNKY--------------- 375

PavSFB9 354 KYDEIEFLFSITYIKSLVLLNND--------------- 376

PavSLFL1-S1 380 -SSSD--FETIVYVNSLVSIIGRHQA------------ 402

PavSLFL1-S2 384 -SPSD--FETVVYVNSLVPITGGNKLESADI------- 411

PavSLFL1-S4 383 -SPSD--FETILYVNSLVPITGGNKLES---------- 407

PavSLFL1-S6 382 -SLSD--FETIVYVNSLVSITRGNKLESVDI------- 409

PavSLFL2-S4 397 LGEPTN-IQAVPYVNSIVSIKPGNKIESI--------- 424

PavSLFL3-S4 388 VSRGD--FQAVVCVNSIVSVKCDNKFETKDY------- 416

PmSFB1 354 KYGDIEFLFAITYIESLVLSN-Y--------------- 375

PmSFB3 353 KYGEIEFLFALTYIESLLLLNNYIADV----------- 379

PmSLF7 353 TYGEIEFLFSVTYIETLVLLNSLQY------------- 377

PmSLFL1-Sf 383 -SPSD--FETILYVNSLVPITGGNKLGSVDM------- 410

PmSLFL2-S1 401 LGEPTN-IQAVPYVNSIVSIKPGNKIESI--------- 428

PmSLFL2-S7 401 LGEPTN-IQAVPYVNSIVSIKPGNKIESI--------- 428

PmSLFL2-Sf 402 LGEPTN-IQAVPYVNSIVSIKPGNKIESI--------- 429

PmSLFL3-S7 379 ASRGD--FQAVVCVNSIVSVK----------------- 397

PmSLFL3-Sf 389 ASRGD--FQAVVCVNSIVSVK----------------- 407

PhSLFv 360 FPDTLS---VKVYKECLTSIPKG-SEYSTKVQKF---- 389

PiSLF1 360 FPDSLS---VIVYKECLTSIPKG-SEYSTKVQKF---- 389

PiSLF2 360 FPDSLS---VKVYKECLTSIPKG-SEYSTKVQKF---- 389

PiSLF3 359 FPDSLS---VIVYKECLTSIQNG-SEYSTKVQNF---- 388

PiSLF3A134 348 YPESLR---IIIYRESLTAIPRN-NDC-IELQNFRCN- 379

PiSLFL1 362 HLECMR---AVIYKESLTTIPRV-GEHSPQVQQF---- 391

PiSLFL2b 364 YPKSLR---VLVYQESLISIPKRRCEHGTKFKIC---- 394

PiSLFL2d 359 YPATLR---VIIYKESLTPIPKG-STQVQNF------- 385

Pa17 359 FPGSLS---VIVYKECLTSIPKG-SEFSTKVQKF---- 388

Pa19 360 FPDSLS---VKVYKECLTSIPKG-SEYSTKVQKF---- 389

PaF1 360 FPDSLS---VIVYKECLTSIPKG-SEFSTEVQIF---- 389

NaDD1 359 FPGSMS---VKVYKESLTSIPRG-LKL----------- 381

NaDD2 354 FPTSLR---VIVYKESLTPIPRN-GDG-TVVQLF---- 382

NaDD3 359 CPGSLS---VKVYKESLTSIPSG-SEHSTKVQFF---- 388

NaDD4 359 FPKSLR---VIVFKESLTSIPSG-SEHGTRVQKF---- 388

NaDD5 362 WPESLR---VTIYKESLTLIPKG-SEH----------- 384

NaDD6 364 YPESLR---AIVYKESLISVPK------TKTRAW---- 388

NaDD7 368 VPDTLE---AIVCKESLISIKREREKWS---------- 392

NaDD8 362 WPKSLK---ALVYKESLVLIPNE-SEDSPPEEIYLEKI 395

NaDD9 366 WPKSLR---ATVYKESLTLLPKE-SEHNKQVQF----- 394

NaDD10 358 WPESLR---ATIYKECLTLIPKG-SEHPTEVKIF---- 387

AhSLF1E 354 VEETLR---VLIVDESLISLNRVLN--F---------- 376

AhSLF2 354 VEETLR---VLIVDESLISLNRVLN--L----------- 376

AhSLF2C 364 VEKTMR---AMIYKESLISLNQVYINLFNKLLHGW--- 395

AhSLF4 354 VEETLR---VLIVDESLISLNRVLN--F---------- 376

AhSLF5 354 VEETLR---VLIVDESLISLNRVLN--F---------- 376

AmSLFL 354 VEETLR---VLIVDESLISLNRVLN--F---------- 376

AT2G34280 371 RFFSPTTALPLCYFQSLISIL------------------ 391

......


  • Login