Structure and evolution of IDPs
This presentation is the property of its rightful owner.
Sponsored Links
1 / 65

Structure and evolution of IDPs PowerPoint PPT Presentation


  • 81 Views
  • Uploaded on
  • Presentation posted in: General

Structure and evolution of IDPs. Peter Tompa. Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary. Why do we want to characterize/predict IDPs?. 1) Find new ones (460 in DisProt vs. tens of thousands). 2) Describe our protein.

Download Presentation

Structure and evolution of IDPs

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Structure and evolution of idps

Structure and evolution of IDPs

Peter Tompa

Institute of Enzymology

Hungarian Academy of Sciences

Budapest, Hungary


Structure and evolution of idps

Why do we want to characterize/predict IDPs?

1) Find new ones (460 in DisProt vs. tens of thousands)

2) Describe our protein


Structure and evolution of idps

Why do we want to describe the structure of IDPs in detail?

Extend the structure-function paradigm


Structure and evolution of idps

To characterize…

In the free state

Structure

In the bound state


Structure and evolution of idps

Structural levels

Sequence (primary)

Local (secondary)

Structure

Global (tertiary)


Structure and evolution of idps

1) Primary structure


Structure and evolution of idps

Primary structure (sequence) of IDPs

Dunker et al. (2001) J. Mol. Graph. Model. 19, 26


Structure and evolution of idps

Low-complexity regions in proteins

Wootton (1994) Comp. Chem. 18, 269


Structure and evolution of idps

Low complexity:Drosophila mastermind


Structure and evolution of idps

Drosophila mastermind

MDAGGLPVFQSASQAAAAAVAQQQQQQQQQQQQQQQQQQQHLNLQLHQQHLQQQQSLGIHLQQQQQLQLQQQQQHNAQAQQQ

QQLQVQQQQQQRQQQQQQQQQHSLYNANLAAAGGIVGGLVPGGNGAGGVALQQVFGGPNGNNNSNNNNNSNNNSININNGNI

SPGDGLPTKRQPILDRLRRRMENYRRRQTDCVPRYEQTFSTVCEQQNHETSALQKRFLESKNKRAAKKTEKKLPETQQQAQT

QMLAGQLQSSVHVQQKILKRPADDVDNGAENYEPPQKLPNNNNNNNNNNNNNNNSSSGVGGGSENLTKFSVEIVQQLEFTTS

AANSQPQQISTNVTVKALTNTSVKSEPGVGGGRGRHQQQQQHQQHQQQQHQQQQHQQHQQHQQQQQHQQQQHQQQQHQQQQQ

QHHHQQQQQQGGGLGGLGNNGRGGGGPGGGGHMATGPGGVGVGMGPNMMSAQQKSALGNLANLVECKREPDHDFPDLGSLAK

DGANGQFPGFPDLLGDDNSENNDTFKDLINNLHDFNPSFLDGFDEKPLLDIKTEDGIKVEPPNAQDLINSLNVKSETGLGHG

FGGFGVGLGLDPQSMKMRPGVGFQNGPNGNANAGNGGPTAGGGGGGNGPGGLMSEHSLAAQTLKQMAEQHQHKSAMGGMGGF

HVPPHGMQQQQPQQQQQAPQQQQQQHGQMMGGPGQGQQQQQQQQPRYNDYGGGFPNDFAMGPNPTQQQQQHLPPQFHQKAPG

GGPGMNVQQNFLDIKQELFYSSPNDFDLKHLQQQQAMQQQQQQQQQQQQQQQHHAQQQQQHPNGPNMGVPMGGAGNFAKQQQ

QQVPTPQQQQQQQLQQQQQQYSPFSNQNANANFLNCPPRGGPQGNQAPGNMPQQQQQQPQQQQQPPRGPQSNPNAVPGGNAA

NATQQQQQQQQQQQQQQQQQQQQQQQATTTTLQMKQTQQLHISQQGGGSHGIQVSAGQHLHLSSDMKSNVSVAAQQGVFFSQ

QQAAQQQQQQQQQPGNAGPNPQQQQQQPHGGNAGANGGGPNGPQQQQPNQNMNNSNVPSDGFSLSQSQSMNFTQQQQQQAAA

AAAAAAAAQQQQAAAAQQQQQQVPPNMRQRQTQAQAAAAAAAAAAAQAQAAANANGGPGGNVPLMQQQQQTPGGVPVGAGSG

NASVGVPVSAGGPNNGAMNQLGGPMGGMPGMQMGGPGGVPINPMQMNPNGGAPNAQMMMGGNGGGPVPAASQAKFLQQQQIM

RAQAMQHQQQVQQHMAGARPPPPEYNATKAQLMQAQMMQQTVGGGGGGGVGVGVGVGGGVGGGGGAGRFPNSAAQAAAMRRM

TQQPIPPSGPMMRPQHAAMYMQQHGGAGGGPRGGMGGPYGGGGVGGAGGPMGGGGGGQQQQQRPPNVQVTPDGMPMGSQQEW

RHMMMTQQQQQMGFGPGGPMRQGPGGFNGGNFMPNGAPNAPGNGPNGGGGGGMMPGPNGPQMQLTPAQMQQQHMRQQQQQQH

MGPGGGGGGGGGNMQMQQLLQQQQNAAAGGGGGMMATQMQMTSIHMSQTQQQQQLTMQQQQFVQSTSTTTTHQQQQQLQLQM

QSQSGGPGGNGPSNNNGANQAGGVGVGVGVGVGVGVVGSSATIASASSISQTINSVVANSNDLCLEFLDNLPDGNFSTQDLI

NSLDNDNFNIQDILQ


Structure and evolution of idps

2) Secondary structure

Structure in the free state (3 examples)


Structure and evolution of idps

CREB-KID - CBP-KIX binding and NMR

Radhakrishnan et al. (1998) FEBS Lett. 430, 317


Structure and evolution of idps

FlgM: evidence for disorder in vivo

Plaxco and Gross (1997) Nature, 386, 657


Structure and evolution of idps

FlgM - sigma 28 binding and NMR

Sorenson (2004) Mol. Cell 14, 127


Structure and evolution of idps

p27 – CycA/Cdk2 binding (NMR, MD)

Sivakolundu et al. (2005) JMB 353, 1118


Structure and evolution of idps

And a fourth: polyproline II helix

SH3-PPII

Wikipedia


Structure and evolution of idps

PPII

PPII helix conformation is common in IDPs

Dominates in :

a-casein

a-synuclein

tau

wheat gluten

Raman optical activity (ROA)

Syme et al. (2002) EJB 269, 148


Structure and evolution of idps

2) Secondary structure

Structure in the bound state


Structure and evolution of idps

p27Kip1

Tcf3

IA3

Cdk2

Asp prot.

FnBP

fibronectin

CycA

b-catenin

Complexes of IDPs in PDB


Structure and evolution of idps

31.3 %

21.9 %

44.8 %

10.9 %

Secondary structural elements

Helix

globular

IDP


Structure and evolution of idps

Comparison of free and bound states:

what does it tell us ?


Structure and evolution of idps

Local secondary structural elements in IDPs:

molecular recognition

1) disorder pattern

molecular recognition element

MoRE, MoRF

2) consensus sequence:

linear motif

LM, ELM, SLiM

3) local predictable structure

preformed structural element

PSE


Structure and evolution of idps

1) Disorder pattern: MoRE in tumor suppressor p53

Uversky et al. (2005) J. Mol. Recogn. 18, 343


Structure and evolution of idps

2) Consensus sequences: ELMs


Structure and evolution of idps

ELMs and local disorder

Fuxreiter et al (2006) Bioinformatics, 23, 950


Structure and evolution of idps

3) Predictability of structure: preformed structural elements, PSEs

p27Kip1

Tcf3

IA3

Cdk2

Asp prot.

FnBP

fibronectin

CycA

b-catenin


Structure and evolution of idps

PSE: predictability of secondary structure

IDP

Partner

Fuxreiter et al. (2004) JMB 338, 1015


Structure and evolution of idps

MoRE

PSE

MorE, LM, PSE: devices of effective recognition


Structure and evolution of idps

Sequential mechanism of p27 binding

45

Lacy et al (2004) NSMB 11, 358


Structure and evolution of idps

3) Tertiary structure


Structure and evolution of idps

Structural ensemble of a-synuclein

(NMR paramagnetic relaxation enhancement)

Dedmon et al. (2005) JACS 127, 476


Structure and evolution of idps

SAXS distance-distribution function and

topology of cellulase E

Von Ossowski et al. (2005) Biophys. J. 88, 2823


Structure and evolution of idps

Global (tertiary) structure of IUPs

IUPRC

U (RC)

IUPPMG

PMG

MG

Native

Uversky (2002) Prot. Sci. 11, 739


Structure and evolution of idps

p27

A lesson from denatured states of globular proteins:

spatial topology in denatured state resembles native structure (David Shortle)

Gillespie et al (1997) JMB 268, 170


Structure and evolution of idps

Models

Protein trinity

Protein quartet

ordered

ordered

PMG

molten globule

random coil

MG

RC

(Dunker)

(Uversky)


Structure and evolution of idps

The evolution of protein disorder

Generation

Evolution


Structure and evolution of idps

Disorder in complete genomes (PONDR)

Dunker et al. (2000) Genome Inf. 11, 161


Structure and evolution of idps

Disorder in complete genomes (DISOPRED)

Ward et al. (2004) JMB 337, 635


Structure and evolution of idps

IDPs: high frequency in proteomes

yeast

coli

Tompa et al. (2006) J. Prot. Res5, 1996


Structure and evolution of idps

Structural disorder: evolutionary success story

LDR (40<) protein, %

60

E

40

A

20

B

0

Domain of life

Vucetic et al. (2002) Proteins 52, 573


Structure and evolution of idps

The evolution of protein disorder

de novogeneration

Generation

gene duplication

lateral gene transfer, LGT

Evolution


Structure and evolution of idps

The evolution of protein disorder

de novogeneration

Generation

gene duplication

lateral gene transfer, LGT

Evolution

Pointmutation

Mutations


Structure and evolution of idps

Rapid evolution by point mutations

Brown et al. (2002) J. Mol. Evol. 55, 104


Structure and evolution of idps

Non-synonymous vs. synonymous substitutions

Synonymous (Ks)

Point mutations

Non-synonymous (Ka)

Nonsense

0.1-0.2: „functional”

Evolution (Ka/Ks):

1.0: „neutral”

1.0: „adaptive”


Structure and evolution of idps

Rapid evolution of SRY gene

SRY: sex determining region on the Y chromosome

(testis determining factor)


Structure and evolution of idps

The evolution of protein disorder

de novogeneration

Generation

gene duplication

lateral gene transfer, LGT

Evolution

Pointmutation

Mutations

Repeat expansion


Structure and evolution of idps

RNA polymerase II


Structure and evolution of idps

RNAP II CTD: coordination of 5’ capping, splicing, 3’ polyadenylation of mRNA

TFs

Initiation

Elongation

Termination

CTDK


Structure and evolution of idps

Yeast RNAP II CTD

IGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGV

TPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMA

GGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSP

GFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSP

SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP

SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP

SYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP

SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSP

AYSPKQDEQKHNENENSR


Structure and evolution of idps

RNAP II CTD evolution

repeat number

-SPSYSPT-

time (GYr)


Structure and evolution of idps

Repeats in IUPs and other datasets

proteins

residues

Tompa (2003) BioEssays 25, 847


Structure and evolution of idps

Functional microsatellites (short repeats) in IDPs


Structure and evolution of idps

SFRS6_HUMAN Splicing factor

MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKN

GYGFVEFEDSRDADDAVYELNGKELCGERVIVEHA

RGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPP

VRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYAD

AHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRN

IRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRR

SSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRS

KSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRS

PKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSV

SPPPKRATSRSRSRSRSKSRSRSRSSSRD


Structure and evolution of idps

Mouse SRY (testis determining factor)

MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQQQQQQQQQQQFHNHHQQQQQFYDHHQQQQQQQQQQQQFHDHHQQKQQFHDHHQQQQQFHDHHHHHQEQQFHDHHQQQQQFHDHQQQQQQQQQQQFHDHHQQKQQFHDHHHHQQQQQFHDHQQQQQQFHDHQQQQHQFHDHPQQKQQFHDHPQQQQQFHDHHHQQQQKQQFHDHHQQKQQFHDHHQQKQQFHDHHQQQQQFHDHHQQQQQQQQQQQQQFHDQQLTYLLTADITGEHTYQEHLSTALWLAVS


Structure and evolution of idps

Functional minisatellites (long repeats) in IDPs


Structure and evolution of idps

INVO_HUMAN Involucrin

MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMK

QPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGL

PEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPE

QQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVK

RDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKH

PEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQE

GQLELPEQQEGQLELPQQQEGQLELSEQQEGQLEL

SEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQM

GQLKYLEQQEGQLKHLDQQEQEGQLEQLEEQEGQL

KHLEQQEGQLEHLEHQEGQLGLPEQQVLQLKQLEK

QQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQL

EQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQG

QLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHL

EKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDG

QLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQ

DIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK


Structure and evolution of idps

PRIO_HUMAN major prion protein

................SDLGLCKKRPKPGGWNTGG

SRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHG

GGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKP

KTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIH

FGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNF

VHDCVNITIKQHTVTTTTKGENFTETDVKMMERVV

EQMCITQYERESQAYYQRGSSMVLFSSPPVILLIS

FLIFLIVG


Structure and evolution of idps

IUPs often evolve by repeat expansion


Structure and evolution of idps

Basic mechanisms of repeat expansion

Meiotic: replication slippage (micro)

Mitotic: unequal crossing over (mini)


Structure and evolution of idps

Replication slippage

Wells RD (2001) JBC 271, 2875)


Structure and evolution of idps

(Unequal) crossing over

Morgan 1916


Structure and evolution of idps

Evolution of repetitive regions in IUPs

Tompa (2003) BioEssays 25, 847


  • Login